DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and AT3G62120

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_191771.1 Gene:AT3G62120 AraportID:AT3G62120 Length:530 Species:Arabidopsis thaliana

Alignment Length:488 Identity:94/489 (19%)
Similarity:164/489 (34%) Gaps:120/489 (25%)


  Fly    16 KNAVVKQTEQLSRSQKLLTE--------------------LGL-VKSGSN--------------- 44
            |..|||:.::..:.:|::.|                    ||| ||...|               
plant     8 KEKVVKEKKEKVKKEKVVKEKVAKASSSGQKKKDVKKETGLGLSVKKDENFGEWYSEVCKQDMIE 72

  Fly    45 -----GTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITLPI-LTPTGLWKKTGRLDGDISEFYMV 103
                 |.|.:.|.:....:.......:.:::...:....|: ::|..|.|:...::|...|...|
plant    73 YYDISGCYILRPWSMAIWEIMQIFFDAEIKKMKVKNCYFPLFVSPGVLEKEKDHIEGFAPEVAWV 137

  Fly   104 RDRSGKQFLMSPTHEEAVTAMLATTSPISY----------RQLPLRLFQIGPKFRDELKTRFGLM 158
             .:|||..|      |...|:..|:..:.|          |.|||:|.|.....|.|.......:
plant   138 -TKSGKSDL------EVPIAIRPTSETVMYPYYSKWIRGHRDLPLKLNQWCNVVRWEFSNPTPFI 195

  Fly   159 RAKEFLMKDMYSFDVSEETAMETYTLVNAAYDRLFKQ-LEVPFVKVNAATGIMGGSVSHEYHYVS 222
            |::|||.::.::...::..|.|....:...|.|:::: |.||.||        |....:|     
plant   196 RSREFLWQEGHTAFATKAEADEEVLQILELYRRIYEEYLAVPVVK--------GMKSENE----- 247

  Fly   223 PVGEDNLLQCSSCGFAGNSEVVKAPASCPSCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNT 287
                         .|||........|..|:..       |||:.|.:..||..::|.....|.|.
plant   248 -------------KFAGGLYTTSVEAFIPNTG-------RGVQGATSHCLGQNFAKMFEINFENE 292

  Fly   288 TGKPQSLVMGCYGIGITRVIAAALEVLSSDHELRWPKLLAPYDVCLIG-PKQGSKEQPEAEVIEN 351
            ..:.:.:....:... ||.|...:.....|..|..|..:|...|.:|. |.:.:..|.    |.:
plant   293 KAETEMVWQNSWAYS-TRTIGVMIMTHGDDKGLVLPPKVASVQVVVIPVPYKDANTQG----IYD 352

  Fly   352 ELLLNVGEICGHQELLHDD-RKELTIGKRLLEAKRLGHPLTIVVGAKSARLDSPKLEVHTSKGET 415
            ........:|.......:| |...:.|.:..:.:..|.||.|.:|.:....|.            
plant   353 ACTATASALCEAGIRAEEDLRDNYSPGWKYSDWEMKGVPLRIEIGPRDLENDQ------------ 405

  Fly   416 YELDFSETLKLVAEHSQHKKSLERGCFQSETEE 448
                    ::.|...:..|:.:.||......:|
plant   406 --------VRTVRRDNGVKEDIPRGSLVEHVKE 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 89/461 (19%)
ProRS_core_prok 24..313 CDD:238402 66/342 (19%)
ProRS_anticodon_short 328..428 CDD:238438 16/102 (16%)
AT3G62120NP_191771.1 PRK08661 52..530 CDD:236327 85/445 (19%)
ProRS_core_arch_euk 57..317 CDD:238401 59/301 (20%)
ProRS_anticodon_zinc 323..530 CDD:238439 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.