DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and eprs

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_009291485.1 Gene:eprs ZFINID:ZDB-GENE-030131-638 Length:1690 Species:Danio rerio

Alignment Length:444 Identity:89/445 (20%)
Similarity:153/445 (34%) Gaps:94/445 (21%)


  Fly    44 NGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSG 108
            :|.|.:.|.:....|...:.....:::.|.:....|:.......:|......|.:.......|||
Zfish  1222 SGCYVLRPWSYSIWDAIKEFFDREIKKLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSG 1286

  Fly   109 KQFLMSPTHEEAVTAMLATTSPI----------SYRQLPLRLFQIGPKFRDELKTRFGLMRAKEF 163
            |..|..|      .|:..|:..:          |:|.||::|.|.....|.|.|.....:|.:||
Zfish  1287 KTELAEP------IAVRPTSETVMYPAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREF 1345

  Fly   164 LMKDMYSFDVSEETAMETYTLVNAAYDRLFKQL-EVPFVKVNAATGIMGGSVSHEYHYVSPVGED 227
            |.::.::...::|.|.|....:...|.|::::| .:|.||        |.....|          
Zfish  1346 LWQEGHTAFATKEEATEEVLQILDLYARVYEELMAIPVVK--------GRKTEKE---------- 1392

  Fly   228 NLLQCSSCGFAGNSEVVKAPASCPSCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLN--TTGK 290
                    .|||........|..    |:..:.::|....|   ||..:|:.....|.:  ..|:
Zfish  1393 --------KFAGGDYTTTVEAFI----SASGRAIQGATSHH---LGQNFSRMFEIVFEDPKKPGE 1442

  Fly   291 PQSLVMGCYGIGITRVIAAALEVLSSDHELRWPKLLAPYDVCL---IGPKQGSKEQPEAEVIENE 352
            .|......:|| .||.|.    ||:..|......:|.|...||   |.|...:...|||   |.:
Zfish  1443 KQLAYQNSWGI-TTRTIG----VLTMVHGDNMGLVLPPRVACLQVIIIPCGITATLPEA---EKD 1499

  Fly   353 LLL-------------------------NVGEICGHQEL------LHDDRKELTIGKRLLEAKRL 386
            |||                         :.|....|.||      .....|:|..|:.:...:..
Zfish  1500 LLLDQCSKYLSRLQKADIRVKADLRDNYSPGWKFNHWELKGVPIRFEVGPKDLKQGQFVAVRRDT 1564

  Fly   387 GHPLTIVVGAKSARLDSPKLEVHTSKGETYELDFSETLKLVAEHSQHKKSLERG 440
            |..:|:.......::.:...|:..:..:....|.::.:.:.....|.:|.|::|
Zfish  1565 GEKITVKEADAEKKIPNLLEEIQNNLFKRASDDLNKHMVVADTMEQFQKDLDQG 1618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 85/425 (20%)
ProRS_core_prok 24..313 CDD:238402 58/282 (21%)
ProRS_anticodon_short 328..428 CDD:238438 23/134 (17%)
eprsXP_009291485.1 PLN02907 1..717 CDD:215492
GST_C_GluProRS_N 73..153 CDD:198342
tRNA-synt_1c 196..497 CDD:279135
tRNA-synt_1c_C 510..687 CDD:281883
Med25_SD1 716..901 CDD:288132
WEPRS_RNA 762..811 CDD:238473
WHEP-TRS 841..892 CDD:278865
WEPRS_RNA 911..960 CDD:238473
WEPRS_RNA 996..1045 CDD:238473
WHEP-TRS 1080..1132 CDD:278865
PRK08661 1197..1690 CDD:236327 89/445 (20%)
ProRS_core_arch_euk 1201..1464 CDD:238401 60/286 (21%)
ProRS_anticodon_zinc 1470..1690 CDD:238439 28/153 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.