DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and ThrRS

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001285868.1 Gene:ThrRS FlyBaseID:FBgn0027081 Length:747 Species:Drosophila melanogaster

Alignment Length:436 Identity:79/437 (18%)
Similarity:157/437 (36%) Gaps:91/437 (21%)


  Fly    16 KNAVVKQTEQLSRSQKL--LTELGLVKSGSNGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITL 78
            :.|..:...::.|.|:|  ..||      |.|:....|......:..:..:::..::.|.|::..
  Fly   342 EEAAKRDHRKIGREQELFFFHEL------SPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVIS 400

  Fly    79 PILTPTGLWKKTGRLD---GDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPISYRQLPLRL 140
            |.:....||..:|...   .::..|...:::...:.:..|.|     .::......|:|:||||:
  Fly   401 PNIYNAKLWMTSGHWQHYAENMFSFEAEKEKFALKPMNCPGH-----CLIFDNRNRSWRELPLRM 460

  Fly   141 FQIGPKFRDELKTRF-GLMRAKEFLMKDMYSFDVSEETAME----------TYTLVNAAY----- 189
            ...|...|:||.... ||.|.:.|...|.:.|...|:...|          .||:...::     
  Fly   461 ADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLS 525

  Fly   190 ---DRLFKQLEVPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSSCGFAGNSEVVKAPASCP 251
               |....:||    :.|.|...:..|::   .:..|..|:.    ....|.|           |
  Fly   526 TRPDNYLGELE----QWNDAEKALAESLN---EFGMPWKENP----GDGAFYG-----------P 568

  Fly   252 SCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSLVMGCYGIGITRVIAAALE---- 312
            ..:.:.:..::......|..|..:.......:::...|:.:..|:      |.|.|..::|    
  Fly   569 KIDITIMDALKRAHQCATIQLDFQLPIRFNLSYIADDGEKKRPVI------IHRAILGSVERMIA 627

  Fly   313 VLSSDHELRWPKLLAPYDVCL--IGP-----KQGSKEQPEAEVIENELLLNVGEICGHQELLHDD 370
            :|:.:...:||..|:|..|.:  :||     .|..::|.......:|...:.|:           
  Fly   628 ILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQSVRDQLHDAGFMSEADCDAGD----------- 681

  Fly   371 RKELTIGKRLLEAKRLGHPLTIVVGAKSARLDSPKLEVHTSK--GE 414
                |:.|::..|:.......:|||.|....::..:....:|  ||
  Fly   682 ----TMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKVHGE 723

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 79/437 (18%)
ProRS_core_prok 24..313 CDD:238402 56/317 (18%)
ProRS_anticodon_short 328..428 CDD:238438 18/97 (19%)
ThrRSNP_001285868.1 PLN02908 79..740 CDD:178496 79/437 (18%)
TGS_ThrRS_N 109..170 CDD:133437
tRNA_SAD 276..323 CDD:197931
ThrRS_core 347..643 CDD:238394 60/335 (18%)
ThrRS_anticodon 643..734 CDD:238437 18/97 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C55077716
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.