DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and Pars2

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_006238574.1 Gene:Pars2 RGDID:1305345 Length:480 Species:Rattus norvegicus

Alignment Length:440 Identity:188/441 (43%)
Similarity:276/441 (63%) Gaps:21/441 (5%)


  Fly     3 KASRIFCPALITPKNAVVKQTEQLS----------RSQKLLTELGLVKSGSNGTYQIMPMAQRSV 57
            :..|:....:..|:|  :::.:.||          :||:|:.::||:...|.|.|.:||...|:|
  Rat    41 RGQRLVVSRMFQPQN--LREDQVLSLEGRASDLTCKSQRLMLQVGLILPASPGCYHLMPYTVRAV 103

  Fly    58 DKCIDLVQSNMQQAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSGKQFLMSPTHEEAVT 122
            :|.:.::...||..|||||.:|.|:|..||:.|||.|....|...::||.||::.:.||||||||
  Rat   104 EKLVRVIDQEMQAIGGQKINMPSLSPAELWRATGRWDLMGRELLRLKDRHGKEYCLGPTHEEAVT 168

  Fly   123 AMLATTSPISYRQLPLRLFQIGPKFRDELKTRFGLMRAKEFLMKDMYSFDVSEETAMETYTLVNA 187
            |::|:...:||:||||.|:|:..|||||.:.||||:|.:||.|||||:||.|.|.|.|||:||..
  Rat   169 ALVASQKKLSYKQLPLLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSSEAAQETYSLVCD 233

  Fly   188 AYDRLFKQLEVPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSSCGFAGNSEVVK-APASCP 251
            ||.|||.:|.:.::|..|..|.:||::|||:.....:|||.|:.|.||.|:.|:|:|. :...||
  Rat   234 AYCRLFDRLGLRWMKARADVGSIGGTMSHEFQLPVDIGEDRLVVCPSCHFSANTEIVDLSQKICP 298

  Fly   252 SCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSLVMGCYGIGITRVIAAALEVLSS 316
            .| ...|.|.:|:||.|||.||.|||....|.|.|..|:.....|||||:|:||::|||:||||:
  Rat   299 DC-QGPLTETKGIEVGHTFYLGTKYSSIFNAHFTNAHGESLLAEMGCYGLGVTRILAAAIEVLST 362

  Fly   317 DHELRWPKLLAPYDVCLIGPKQGSKEQPEAEVIE---NELLLNVGEICGHQELLHDDRKELTIGK 378
            :..:|||.|||||.||:|.||:||||....|::|   :::...:.::.|  |:|.|||..||||.
  Rat   363 EDCIRWPSLLAPYQVCIIPPKKGSKEAAATEIVERLYDDVTEALPQLRG--EVLLDDRTHLTIGN 425

  Fly   379 RLLEAKRLGHPLTIVVGAKSARLDSPKLEVHT-SKGETYELDFSETLKLV 427
            ||.:|.:||:|. :::.:|.|..|....||.: :.||...|.....::|:
  Rat   426 RLKDANKLGYPF-VIIASKRALEDPAHFEVWSQNTGEVVFLTKEGVMELL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 187/434 (43%)
ProRS_core_prok 24..313 CDD:238402 138/300 (46%)
ProRS_anticodon_short 328..428 CDD:238438 38/105 (36%)
Pars2XP_006238574.1 PRK09194 47..475 CDD:236405 187/435 (43%)
ProRS_core_prok 70..359 CDD:238402 136/290 (47%)
ProRS_anticodon_short 374..475 CDD:238438 38/105 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130422400
eggNOG 1 0.900 E1_COG0442
Hieranoid 1 1.000
Homologene 1 1.000 H5830
Inparanoid 1 1.050 349 1.000 Inparanoid score I2187
OMA 1 1.010
OrthoDB 1 1.010 D307110at33208
OrthoFinder 1 1.000 FOG0003944
OrthoInspector 1 1.000 T1088894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR42753
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.