DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and PARS2

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_689481.2 Gene:PARS2 HGNCID:30563 Length:475 Species:Homo sapiens

Alignment Length:410 Identity:185/411 (45%)
Similarity:258/411 (63%) Gaps:9/411 (2%)


  Fly     5 SRIFCPALITPKNAVV---KQTEQLSRSQKLLTELGLVKSGSNGTYQIMPMAQRSVDKCIDLVQS 66
            ||:|.|..:.....:.   |..:...:||:|:.::||:...|.|.|.::|...|:::|.:.::..
Human    43 SRVFQPQNLREDRVLSLQDKSDDLTCKSQRLMLQVGLIYPASPGCYHLLPYTVRAMEKLVRVIDQ 107

  Fly    67 NMQQAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPI 131
            .||..||||:.:|.|:|..||:.|.|.|....|...:|||.||::.:.||||||:||::|:...:
Human   108 EMQAIGGQKVNMPSLSPAELWQATNRWDLMGKELLRLRDRHGKEYCLGPTHEEAITALIASQKKL 172

  Fly   132 SYRQLPLRLFQIGPKFRDELKTRFGLMRAKEFLMKDMYSFDVSEETAMETYTLVNAAYDRLFKQL 196
            ||:|||..|:|:..|||||.:.||||:|.:||.|||||:||.|.|.|.:||:||..||..||.:|
Human   173 SYKQLPFLLYQVTRKFRDEPRPRFGLLRGREFYMKDMYTFDSSPEAAQQTYSLVCDAYCSLFNKL 237

  Fly   197 EVPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSSCGFAGNSEVVK-APASCPSCNSSDLKE 260
            .:|||||.|..|.:||:||||:.....:|||.|..|..|.|:.|.|.:. :..:||:| ...|.:
Human   238 GLPFVKVQADVGTIGGTVSHEFQLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPAC-QGPLTK 301

  Fly   261 VRGVEVAHTFLLGDKYSKPLGATFLNTTGKPQSLVMGCYGIGITRVIAAALEVLSSDHELRWPKL 325
            .:|:||.|||.||.|||....|.|.|..|||....|||||:|:||::|||:||||::..:|||.|
Human   302 TKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAEMGCYGLGVTRILAAAIEVLSTEDCVRWPSL 366

  Fly   326 LAPYDVCLIGPKQGSKEQPEAEVIENELLLNVGEICG--HQELLHDDRKELTIGKRLLEAKRLGH 388
            ||||..|||.||:|||||..:|:| .:|..::.|...  |.|:|.|||..||||.||.:|.:.|:
Human   367 LAPYQACLIPPKKGSKEQAASELI-GQLYDHITEAVPQLHGEVLLDDRTHLTIGNRLKDANKFGY 430

  Fly   389 PLTIVVGAKSARLDSPKLEV 408
            |..|:.| |.|..|....||
Human   431 PFVIIAG-KRALEDPAHFEV 449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 185/411 (45%)
ProRS_core_prok 24..313 CDD:238402 133/290 (46%)
ProRS_anticodon_short 328..428 CDD:238438 38/84 (45%)
PARS2NP_689481.2 ProRS_core_prok 65..354 CDD:238402 133/290 (46%)
HGTP_anticodon 369..470 CDD:320868 38/84 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130420737
eggNOG 1 0.900 E1_COG0442
Hieranoid 1 1.000
Homologene 1 1.000 H5830
Inparanoid 1 1.050 353 1.000 Inparanoid score I2219
Isobase 1 0.950 0 Normalized mean entropy S2325
OMA 1 1.010
OrthoDB 1 1.010 D307110at33208
OrthoFinder 1 1.000 FOG0003944
OrthoInspector 1 1.000 T1075238
orthoMCL 1 0.900 OOG5_128299
Panther 1 1.100 LDO PTHR42753
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1453
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.