DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and pars-2

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001040689.1 Gene:pars-2 WormBaseID:WBGene00004190 Length:454 Species:Caenorhabditis elegans

Alignment Length:435 Identity:162/436 (37%)
Similarity:234/436 (54%) Gaps:57/436 (13%)


  Fly    27 SRSQKLLTELGLVKSGSNGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITLPILTPTGLWKKTG 91
            |.:..:|.|.|.:...:.|.|.::|:.||.:||...::....|.:|..||.:||:....||:|||
 Worm    20 SMAHTMLVENGFILPTAKGFYSLLPLGQRVIDKLCRILDVEFQNSGALKIAMPIVGTQQLWEKTG 84

  Fly    92 RLDGDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPISYRQLPLRLFQIGPKFRDELKTRFG 156
            |.:....|.....||......:.||.||..|.::||.||:...|.||.::|||.|||||:..|||
 Worm    85 RWEAMGPEMIRFHDRQQNHMCLQPTAEEMCTELIATLSPLKKSQFPLIVYQIGEKFRDEMNPRFG 149

  Fly   157 LMRAKEFLMKDMYSFDVSEETAMETYTLVNAAYDRLF---KQLEVPFVKVNAATGIMGGSVSHEY 218
            |||.::|||||||||....||:.:||..:...|||:|   .||:...:||.|.:|:.||.:||||
 Worm   150 LMRGRQFLMKDMYSFSTDAETSQQTYAQIRQIYDRIFGEILQLDEDVIKVEADSGVHGGHISHEY 214

  Fly   219 HYVSPVGEDNLLQCSSC----GFAGNSEVVKAPASCPSC---NSSDLKEVRGVEVAHTFLLGDKY 276
            |..|.:.||.:..|.:|    .|.|     ..||.|..|   :|..::::..||:||||.||.||
 Worm   215 HLKSSLEEDFVNFCENCKNHNKFEG-----PGPAKCEKCAENSSKTVQKIPSVEIAHTFHLGTKY 274

  Fly   277 SKPLGATFLNTTGKPQSLVMGCYGIGITRVIAAALEVLS-SDHELRWPKLLAPYDVCLIGPKQGS 340
            |:.|||.|   .|||  |.|.|:|||:||::.||:::|| ||..||.|:.:||:|..:|      
 Worm   275 SEALGAKF---QGKP--LDMCCFGIGVTRLLPAAIDLLSVSDKALRLPRAIAPFDAVII------ 328

  Fly   341 KEQPEAEVIENELLLNV-GEICGHQE-------LLHDDRKELTIGKRLLEAKRLGHPLTIVVGAK 397
                    ::..|:.|| .|:.....       :|.|||.|::.|||:.:|.|||.|..:|:..:
 Worm   329 --------VKKSLMSNVIVEMASSSASRYLKGGILLDDRVEMSAGKRIHDANRLGIPFILVIANE 385

  Fly   398 SAR---LDSPKLEVHTSKGETYELDFSETLKLVAEHSQHKKSLER 439
            :.|   ...|.:||.|:..::.|           ..||...||:|
 Worm   386 TERSLATQKPVIEVFTTHAKSAE-----------PMSQGSMSLDR 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 157/417 (38%)
ProRS_core_prok 24..313 CDD:238402 122/296 (41%)
ProRS_anticodon_short 328..428 CDD:238438 27/111 (24%)
pars-2NP_001040689.1 ProRS_core_prok 18..305 CDD:238402 122/295 (41%)
PRK09194 23..399 CDD:236405 153/400 (38%)
ProRS_anticodon_short 322..425 CDD:238438 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130418128
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H5830
Inparanoid 1 1.050 263 1.000 Inparanoid score I1874
Isobase 1 0.950 0 Normalized mean entropy S2325
OMA 1 1.010
OrthoDB 1 1.010 D307110at33208
OrthoFinder 1 1.000 FOG0003944
OrthoInspector 1 1.000 T475774
orthoMCL 1 0.900 OOG5_128299
Panther 1 1.100 LDO PTHR42753
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1453
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.