DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and Eprs

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_001344403.1 Gene:Eprs MGIID:97838 Length:1519 Species:Mus musculus

Alignment Length:453 Identity:94/454 (21%)
Similarity:157/454 (35%) Gaps:116/454 (26%)


  Fly    44 NGTYQIMPMAQRSVDKCIDLVQSNMQQAGGQKITLPI-LTPTGLWKKTGRLDGDISEFYMVRDRS 107
            :|.|.:.|.:....:...|...:.:::.|.:....|| ::...|.|:...::....|...| .||
Mouse  1051 SGCYILRPWSYSIWESIKDFFDAEIKKLGVENCYFPIFVSQAALEKEKNHIEDFAPEVAWV-TRS 1114

  Fly   108 GKQFLMSPTHEEAVTAMLATTSPI----------SYRQLPLRLFQIGPKFRDELKTRFGLMRAKE 162
            ||..|..|      .|:..|:..:          |:|.||:||.|.....|.|.|.....:|.:|
Mouse  1115 GKTELAEP------IAIRPTSETVMYPAYAKWVQSHRDLPVRLNQWCNVVRWEFKHPQPFLRTRE 1173

  Fly   163 FLMKDMYS-FDVSEETAMETYTLVNAAYDRLFKQ-LEVPFVK---------------------VN 204
            ||.::.:| |...||.|.|...::. .|.|:::: |.:|.|:                     ::
Mouse  1174 FLWQEGHSAFATFEEAADEVLQILE-LYARVYEELLAIPVVRGRKTEKEKFAGGDYTTTIEAFIS 1237

  Fly   205 AATGIMGGSVSH----------EYHYVSP--VGEDNL-LQCS----------------------- 233
            |:...:.|:.||          |..:..|  .||... .|||                       
Mouse  1238 ASGRAIQGATSHHLGQNFSKMCEIVFEDPKTPGEKQFAYQCSWGLTTRTIGVMVMVHGDNMGLVL 1302

  Fly   234 ------------SCGFAGNSEVVKAPASCPSCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLN 286
                        .||...........|....||.. .:.:.|..:.....|.|.||.........
Mouse  1303 PPRVASVQVVVIPCGITNALSEEDREALMAKCNEY-RRRLLGANIRVRVDLRDNYSPGWKFNHWE 1366

  Fly   287 TTGKPQSLVMG------CYGIGITRVIAAALEVLSSDHELRWPKLLAPYDVCLIGPKQGSKEQPE 345
            ..|.|..|.:|      |..:.:.|.....|.:...:.|.:..|:|....:.|.  .:.|::...
Mouse  1367 LKGVPVRLEVGPRDMKSCQFVAVRRDTGEKLTIAEKEAEAKLEKVLEDIQLNLF--TRASEDLKT 1429

  Fly   346 AEVIENEL-----LLNVGEI-----CGHQELLHDDRKELTIGKRLLEAKRLGHPLTIVVGAKS 398
            ..|:.|.|     :|:.|::     ||..: ..|..|::|...:.:|.   |.|   .:||||
Mouse  1430 HMVVSNTLEDFQKVLDAGKVAQIPFCGEID-CEDWIKKMTARDQDVEP---GAP---SMGAKS 1485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 94/454 (21%)
ProRS_core_prok 24..313 CDD:238402 72/357 (20%)
ProRS_anticodon_short 328..428 CDD:238438 19/82 (23%)
EprsNP_001344403.1 GlnS 6..718 CDD:332033
'HIGH' region 204..214
'KMSKS' region 432..436
WEPRS_RNA 760..809 CDD:238473
3 X 57 AA approximate repeats 767..963
WEPRS_RNA 833..882 CDD:238473
WEPRS_RNA 911..959 CDD:238473
Proline--tRNA ligase 1014..1519 94/454 (21%)
PRK08661 1026..1519 CDD:236327 94/454 (21%)
L-proline binding. {ECO:0000250|UniProtKB:P07814} 1128..1130 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.