DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ProRS-m and eprs

Sequence 1:NP_647737.1 Gene:ProRS-m FlyBaseID:FBgn0027082 Length:458 Species:Drosophila melanogaster
Sequence 2:XP_002936063.2 Gene:eprs XenbaseID:XB-GENE-966791 Length:1708 Species:Xenopus tropicalis

Alignment Length:499 Identity:108/500 (22%)
Similarity:172/500 (34%) Gaps:125/500 (25%)


  Fly    27 SRSQKLLTELGL-VKSGSN---------------------GTYQIMPMAQRSVDKCIDLVQSNMQ 69
            |:..|..|.||| .|...|                     |.|.:.|.|....:...:.....::
 Frog  1201 SQGPKKQTRLGLEAKKEENLPDWYSQVITKSEMIEYYDVSGCYVLRPWAFAIWEAIKEFFDKEIK 1265

  Fly    70 QAGGQKITLPILTPTGLWKKTGRLDGDISEFYMVRDRSGKQFLMSPTHEEAVTAMLATTSPI--- 131
            :.|.:....|:.......:|......|.:.......||||..|..|      .|:..|:..:   
 Frog  1266 KLGVENCYFPMFVSQAALEKEKTHIADFAPEVAWVTRSGKTELAEP------IAVRPTSETVMYP 1324

  Fly   132 -------SYRQLPLRLFQIGPKFRDELKTRFGLMRAKEFLMKDMY-SFDVSEETAMETYTLVNAA 188
                   |:|.||::|.|.....|.|.|.....:|.:|||.::.: :|...||.|.|...::: .
 Frog  1325 AYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHTAFATYEEAAEEVLQILD-L 1388

  Fly   189 YDRLFKQ-LEVPFVKVNAATGIMGGSVSHEYHYVSPVGEDNLLQCSSCGFAGN--SEVVKAPASC 250
            |.|:::. |.:|.||        |.....|                  .|||.  :..|:|..|.
 Frog  1389 YARVYEDLLAIPVVK--------GRKTEKE------------------KFAGGDYTTTVEAFISA 1427

  Fly   251 PSCNSSDLKEVRGVEVAHTFLLGDKYSKPLGATFLN--TTGKPQSLVMGCYGIGITRVIAAALEV 313
            .|         |.::.|.:..||..:||.....|.:  |.|..|......:|:. ||.|.|...|
 Frog  1428 SS---------RAIQGATSHHLGQNFSKMFEIVFEDPKTPGLKQYAYQNSWGLS-TRTIGAMTMV 1482

  Fly   314 LSSDHELRWPKLLAPYDVCLI--GPKQGSKEQPEAEVIEN-----ELLLNV-------------- 357
            .:.:..:..|..:|...|.:|  |......|:.:..:::.     :.||||              
 Frog  1483 HADNIGMVLPPRVACVQVIIIPCGITNTLSEEDKDALLKKCDQYLKRLLNVDVRARADVRDNYSP 1547

  Fly   358 GEICGHQELLHDDRK----ELTIGKRLLEAKRL-------GHPLTIVVGAKSARLDSPKLEVHTS 411
            |....|.||     |    .|.:|.|.::.|:.       |...||.......||.....|:||:
 Frog  1548 GWKFNHWEL-----KGVPIRLEVGPRDMKNKQFVAVRRDNGEKQTISEDQAETRLKEILEEIHTN 1607

  Fly   412 KGETYELDFSETLKLVAEHSQHKKSLERG-------CFQSETEE 448
            .......|.:..:.:.......:|:||:|       |.:.|.|:
 Frog  1608 LYNRALSDLTSNMVVANTMEDFQKNLEKGRIVQIPFCGEIECED 1651

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ProRS-mNP_647737.1 PRK09194 3..422 CDD:236405 101/465 (22%)
ProRS_core_prok 24..313 CDD:238402 72/324 (22%)
ProRS_anticodon_short 328..428 CDD:238438 26/132 (20%)
eprsXP_002936063.2 PLN02907 52..753 CDD:215492
GST_C_GluProRS_N 124..207 CDD:198342
tRNA-synt_1c 239..544 CDD:279135
tRNA-synt_1c_C 546..723 CDD:281883
WHEP-TRS 798..850 CDD:278865
WEPRS_RNA 869..916 CDD:238473
WHEP-TRS 944..996 CDD:278865
WHEP-TRS 1024..1076 CDD:278865
WHEP-TRS 1104..1156 CDD:278865
PRK08661 1215..1708 CDD:236327 102/486 (21%)
ProRS_core_arch_euk 1219..1482 CDD:238401 65/306 (21%)
ProRS_anticodon_zinc 1488..1708 CDD:238439 35/170 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0442
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.