DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and RBOHD

DIOPT Version :10

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_199602.1 Gene:RBOHD / 834842 AraportID:AT5G47910 Length:921 Species:Arabidopsis thaliana


Alignment Length:438 Identity:77/438 - (17%)
Similarity:130/438 - (29%) Gaps:154/438 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 NNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGDNLTMKS- 736
            |:..:.:.|:|.            .|..|.|..::.:             :|:.:..|:|..:| 
plant    25 NSDTESIASDRG------------AFSGPLGRPKRAS-------------KKNARFADDLPKRSN 64

  Fly   737 ---------EEY-----EFRDLLSREHLHLVAELSGCMEHREMP---------------NCTDMC 772
                     :||     :.||  ....:|.|.:.:|...|.|.|               |.|.:.
plant    65 SVAGGRGDDDEYVEITLDIRD--DSVAVHSVQQAAGGGGHLEDPELALLTKKTLESSLNNTTSLS 127

  Fly   773 F------------------HSR-----YRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMP 814
            |                  .||     .|..|.|.:...|...|....|.:..|.|..:..|...
plant   128 FFRSTSSRIKNASRELRRVFSRRPSPAVRRFDRTSSAAIHALKGLKFIATKTAAWPAVDQRFDKL 192

  Fly   815 VGWTKGMLYSG----------HAKPSARLVSTSLVATKEITPDARITHMVMQ--WGQFLDHDLDH 867
            ...:.|:|.|.          .:|..|..:..:|.....::.|| ||...::  |.|..|...|.
plant   193 SADSNGLLLSAKFWECLGMNKESKDFADQLFRALARRNNVSGDA-ITKEQLRIFWEQISDESFDA 256

  Fly   868 AIPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQ 932
            .:    ...:|.:|                ...|.||......:::..||               
plant   257 KL----QVFFDMVD----------------KDEDGRVTEEEVAEIISLSA--------------- 286

  Fly   933 HREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRN 997
               ..|:|::.  ..|...|:....:||.  ....|.:.:     ...:||...||...:   |.
plant   287 ---SANKLSNI--QKQAKEYAALIMEELD--PDNAGFIMI-----ENLEMLLLQAPNQSV---RM 336

  Fly   998 LDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQ-INSHW 1044
            .|...:|..:|..:|..::...|.          |.:.|:|. |..:|
plant   337 GDSRILSQMLSQKLRPAKESNPLV----------RWSEKIKYFILDNW 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 leucine-rich repeat 54..77 CDD:275380
LRR <55..>184 CDD:443914
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
leucine-rich repeat 126..149 CDD:275380
leucine-rich repeat 150..173 CDD:275380
Ig_3 235..311 CDD:464046
Ig 366..450 CDD:472250
Ig strand B 384..388 CDD:409544
Ig strand C 397..401 CDD:409544
Ig strand E 420..424 CDD:409544
Ig strand F 434..439 CDD:409544
Ig strand G 447..450 CDD:409544
Ig_3 458..533 CDD:464046
Ig 553..644 CDD:472250
Ig strand B 570..574 CDD:409353
Ig strand C 584..588 CDD:409353
Ig strand E 610..614 CDD:409353
Ig strand F 624..629 CDD:409353
Ig strand G 638..641 CDD:409353
peroxidasin_like 898..1338 CDD:188658 27/148 (18%)
VWC 1465..1523 CDD:278520
RBOHDNP_199602.1 NADPH_Ox 158..256 CDD:462469 21/98 (21%)
EFh <237..283 CDD:238008 11/65 (17%)
EF-hand_7 255..317 CDD:463900 15/103 (15%)
PLN02844 <425..>758 CDD:215453
NOX_Duox_like_FAD_NADP 619..921 CDD:99783
NAD_binding_6 736..903 CDD:429792
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.