DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pxn and him-4

DIOPT Version :10

Sequence 1:NP_523891.2 Gene:Pxn / 38326 FlyBaseID:FBgn0011828 Length:1527 Species:Drosophila melanogaster
Sequence 2:NP_001024582.1 Gene:him-4 / 181187 WormBaseID:WBGene00001863 Length:5198 Species:Caenorhabditis elegans


Alignment Length:1377 Identity:264/1377 - (19%)
Similarity:418/1377 - (30%) Gaps:507/1377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTS 300
            |..:.:|...:|....||.|.|...|:|.|:|.|......|......:...|..|:|||..|...
 Worm   793 PTIIESPHTVRVNIERQVTLQCLAVGIPPPEIEWQKGNVLLATLNNPRYTQLADGNLLITDAQIE 857

  Fly   301 DMGIYQCIARNEMGALRSQPVRLVVNG------GNHP------------------LDSPIDARSN 341
            |.|.:.|||||..|. :||...|:|.|      |:.|                  |.:|   :.:
 Worm   858 DQGQFTCIARNTYGQ-QSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTP---KPS 918

  Fly   342 QVWADAGTP-----------------MHGATP---------LPSP-----------LPSPPHFTH 369
            .||.....|                 :.|..|         ..||           |...|.|.:
 Worm   919 IVWIKDDKPVEEGPTIKIEGGGSLLRLRGGNPKDEGKYTCIAVSPAGNSTLHINVQLIKKPEFVY 983

  Fly   370 QPHDQI-------------VALHGSGHVLLD-------CAASGWPQPDIQWFVNGRQLLQSTPSL 414
            :|...|             ||:..|.|.:||       |..||.|.|.|.|:::||.:..::...
 Worm   984 KPEGGIVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPITPNSRDF 1048

  Fly   415 QLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIELKELPEILTAPQSQTIKLGKAFVLEC 479
            .:.|:.:||:.:.::..:|.|.|:|.||.|..:....|.:...|.|.....|..:.:...|.:.|
 Worm  1049 TVTADNTLIVRKADKSYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPC 1113

  Fly   480 DADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATI 544
            |..|:|.|.|.|.|:..|....     :.||:..|.:....:.|.|.:.|.|.|..|..:...|:
 Worm  1114 DVYGDPKPVITWLLDDKPFTEG-----VVNEDGSLTIPNVNEAHRGTFTCHAQNAAGNDTRTVTL 1173

  Fly   545 KVERSQSPPQLAIEPSNLVAITGTTIELPCQADQPEDGLQISWRHDGRLIDPNVQLAEKYQISGA 609
            .|   .:.|.:..|....:|:....|.|.|.|......::: |.::|..||.  ||. .:.|...
 Worm  1174 TV---HTTPTINAENQEKIALQNDDIVLECPAKALPPPVRL-WTYEGEKIDS--QLI-PHTIRED 1231

  Fly   610 GSLFVKNVTIPDGGRYECQLKNQFGRASASALVTIRNN----------VDLAPGDRYVRIAFAEA 664
            |:|.::||.:.:.|.:.||:.|..|..|.|..:|:...          ||:..|........|..
 Worm  1232 GALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATG 1296

  Fly   665 AKEIDLAIN-NTLDMLFSNRSDKAPPNYGELLRVFR-----------FPTGEA--RQLARAAEIY 715
            ..|:....| |.:|:....:.... .|.| .||::.           ..|.||  .|:....::.
 Worm  1297 VPEVIRTWNKNGIDLKMDEKKFSV-DNLG-TLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQ 1359

  Fly   716 ERTLV----NIRKHVQEGDNLTMKSEEYEFRDLLSREHLHLVAELSGCMEHREMPNCTDMCFHSR 776
            |..::    ........||.:.:|                       |......|          
 Worm  1360 EPPIILPSTQTNNTAVVGDRVELK-----------------------CYVEASPP---------- 1391

  Fly   777 YRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGW-TKG-------------------M 821
                             ||:|.|||          .:.:|. |||                   .
 Worm  1392 -----------------ASVTWFRR----------GIAIGTDTKGYVVESDGTLVIQSASVEDAT 1429

  Fly   822 LYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHD-------LDHAIPSVS------ 873
            :|:..|...|.....:|..|...:||.:...:|.|......|.       ..:.:|.:|      
 Worm  1430 IYTCKASNPAGKAEANLQVTVIASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDK 1494

  Fly   874 -----SESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTS-------- 925
                 ..||...|.|:...:      .:....|..|  .:|  |.|::|  |.|..|        
 Worm  1495 PLIDDKTSWKTSDDKRKLHV------FKAKITDSGV--YKC--VARNAA--GEGSKSFQVEVIVP 1547

  Fly   926 LFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQD 990
            |..|..::::::                  ||:|                               
 Worm  1548 LNLDESKYKKKV------------------FAKE------------------------------- 1563

  Fly   991 GMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARK 1055
            |       :|.|:.|.|||                         ..:.|||...|| |:.:..:|
 Worm  1564 G-------EEVTLGCPVSG-------------------------FPVPQINWVVDG-TVVEPGKK 1595

  Fly  1056 IVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLN 1120
            ..||.:.:    ..|.|......::..|.|                       |.:..       
 Worm  1596 YKGATLSN----DGLTLHFDSVSVKQEGNY-----------------------HCVAQ------- 1626

  Fly  1121 ETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAV 1185
                  .:|::|               .:| :....||||  :...|.||...|           
 Worm  1627 ------SKGNIL---------------DID-VELSVLAVP--IVGEDDNLEVFL----------- 1656

  Fly  1186 ALDLAAINIQRGRDHGMPGYNVYRKLCNL-TVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVW 1249
                       |:|..:.        |:| |.:.|.......|:.:|        ...||||.: 
 Worm  1657 -----------GKDISLS--------CDLQTESDDKTTFVWSINGSE--------SDRPDNVQI- 1693

  Fly  1250 LGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGD 1314
                           |             .||.|||           :|..|..|.|:.:|.|.:
 Worm  1694 ---------------P-------------SDGHRLY-----------ITDAKPENNGKYMCRVTN 1719

  Fly  1315 N---------FDQVTENVFILAKHQGGYKKCEDIIGIN--------------LYLWQECGRCNSP 1356
            :         .|.:...||:....:...|    :||.|              ..:|:..|.....
 Worm  1720 SAGKAERTLTLDVLEPPVFVEPVFEANQK----LIGNNPIILQCQVTGNPKPTVIWKIDGNDVDK 1780

  Fly  1357 PAIFD---------------SYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEER 1406
            ..:||               :.|..|...::....||...:|....|.:: :...|:::..:|..
 Worm  1781 SWLFDESLSLLRIEKLTGKSAQISCTAENKAGTASRDFFIQNIAAPTFKN-EGDQETIFRESETI 1844

  Fly  1407 VSGLEELIGSFQ 1418
            .......:|.||
 Worm  1845 TLDCPVSLGDFQ 1856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PxnNP_523891.2 leucine-rich repeat 54..77 CDD:275380
LRR <55..>184 CDD:443914
leucine-rich repeat 78..101 CDD:275380
leucine-rich repeat 102..125 CDD:275380
leucine-rich repeat 126..149 CDD:275380
leucine-rich repeat 150..173 CDD:275380
Ig_3 235..311 CDD:464046 24/74 (32%)
Ig 366..450 CDD:472250 28/103 (27%)
Ig strand B 384..388 CDD:409544 2/10 (20%)
Ig strand C 397..401 CDD:409544 1/3 (33%)
Ig strand E 420..424 CDD:409544 1/3 (33%)
Ig strand F 434..439 CDD:409544 2/4 (50%)
Ig strand G 447..450 CDD:409544 0/2 (0%)
Ig_3 458..533 CDD:464046 20/74 (27%)
Ig 553..644 CDD:472250 25/90 (28%)
Ig strand B 570..574 CDD:409353 2/3 (67%)
Ig strand C 584..588 CDD:409353 0/3 (0%)
Ig strand E 610..614 CDD:409353 2/3 (67%)
Ig strand F 624..629 CDD:409353 1/4 (25%)
Ig strand G 638..641 CDD:409353 1/2 (50%)
peroxidasin_like 898..1338 CDD:188658 74/457 (16%)
VWC 1465..1523 CDD:278520
him-4NP_001024582.1 IgI_1_MuSK 4040..4132 CDD:409562
Ig strand A 4040..4043 CDD:409562
Ig strand A' 4050..4055 CDD:409562
Ig strand B 4061..4068 CDD:409562
Ig strand C 4074..4079 CDD:409562
Ig strand C' 4081..4083 CDD:409562
Ig strand D 4091..4094 CDD:409562
Ig strand E 4098..4104 CDD:409562
Ig strand F 4111..4118 CDD:409562
Ig strand G 4124..4132 CDD:409562
Ig_3 4139..4210 CDD:464046
Ig <4262..4314 CDD:472250
Ig strand E 4280..4284 CDD:409353
Ig strand F 4294..4299 CDD:409353
Ig strand G 4307..4310 CDD:409353
Ig_3 4318..4393 CDD:464046
IG_like 4418..4496 CDD:214653
Ig strand B 4427..4431 CDD:409353
Ig strand C 4440..4444 CDD:409353
Ig strand E 4462..4466 CDD:409353
Ig strand F 4476..4481 CDD:409353
I-set 4570..4654 CDD:400151
Ig strand B 4587..4591 CDD:409353
Ig strand C 4600..4604 CDD:409353
Ig strand E 4621..4624 CDD:409353
Ig strand F 4634..4639 CDD:409353
Ig strand G 4647..4650 CDD:409353
Ig 4752..4836 CDD:472250
Ig strand B 4766..4770 CDD:409353
Ig strand C 4780..4784 CDD:409353
Ig strand E 4802..4806 CDD:409353
Ig strand F 4816..4821 CDD:409353
Ig strand G 4829..4832 CDD:409353
EGF_CA 4996..5027 CDD:238011
EGF_CA 5034..5076 CDD:214542
IG_like 442..515 CDD:214653
Ig strand B 446..450 CDD:409353
Ig strand C 459..463 CDD:409353
Ig strand E 482..486 CDD:409353
Ig strand F 496..501 CDD:409353
Ig strand G 511..514 CDD:409353
IG_like 527..605 CDD:214653
Ig strand B 537..541 CDD:409353
Ig strand C 550..554 CDD:409353
Ig strand E 573..577 CDD:409353
Ig strand F 587..592 CDD:409353
Ig_3 610..683 CDD:464046
I-set 702..789 CDD:400151
Ig strand B 719..723 CDD:409353
Ig strand C 733..737 CDD:409353
Ig strand F 769..774 CDD:409353
Ig strand G 782..785 CDD:409353
I-set 793..881 CDD:400151 30/88 (34%)
Ig strand B 810..814 CDD:409353 2/3 (67%)
Ig strand C 823..827 CDD:409353 1/3 (33%)
Ig strand E 847..851 CDD:409353 2/3 (67%)
Ig strand F 861..866 CDD:409353 1/4 (25%)
Ig strand G 874..877 CDD:409353 2/2 (100%)
Ig 899..974 CDD:472250 9/77 (12%)
Ig strand B 904..908 CDD:409353 0/3 (0%)
Ig strand C 918..922 CDD:409353 1/3 (33%)
Ig strand E 941..945 CDD:409353 0/3 (0%)
Ig strand F 955..960 CDD:409353 0/4 (0%)
I-set 1012..1081 CDD:400151 21/68 (31%)
Ig strand B 1018..1022 CDD:409353 0/3 (0%)
Ig strand C 1031..1035 CDD:409353 1/3 (33%)
Ig strand E 1054..1058 CDD:409353 1/3 (33%)
Ig strand F 1068..1073 CDD:409353 2/4 (50%)
Ig strand G 1081..1084 CDD:409353 0/2 (0%)
Ig strand B 1109..1113 CDD:409353 1/3 (33%)
Ig 1110..1175 CDD:472250 19/69 (28%)
Ig strand C 1122..1126 CDD:409353 1/3 (33%)
Ig strand E 1141..1145 CDD:409353 1/3 (33%)
Ig strand F 1155..1160 CDD:409353 1/4 (25%)
Ig 1181..1266 CDD:472250 24/88 (27%)
Ig strand B 1196..1200 CDD:409353 2/3 (67%)
Ig strand C 1209..1213 CDD:409353 0/4 (0%)
Ig strand E 1232..1236 CDD:409353 2/3 (67%)
Ig strand F 1246..1251 CDD:409353 1/4 (25%)
Ig strand G 1259..1262 CDD:409353 1/2 (50%)
Ig 1270..1358 CDD:472250 16/89 (18%)
Ig strand B 1288..1292 CDD:409353 0/3 (0%)
Ig strand C 1301..1305 CDD:409353 0/3 (0%)
Ig strand E 1324..1328 CDD:409353 2/4 (50%)
Ig strand F 1338..1343 CDD:409353 0/4 (0%)
Ig strand G 1351..1354 CDD:409353 1/2 (50%)
I-set 1373..1450 CDD:400151 19/136 (14%)
Ig strand B 1380..1384 CDD:409353 1/26 (4%)
Ig strand C 1393..1397 CDD:409353 2/3 (67%)
Ig strand E 1417..1420 CDD:409353 0/2 (0%)
Ig strand F 1430..1435 CDD:409353 1/4 (25%)
Ig strand B 1473..1477 CDD:409353 0/3 (0%)
Ig 1474..1544 CDD:472250 15/81 (19%)
Ig strand C 1486..1490 CDD:409353 1/3 (33%)
Ig strand E 1510..1514 CDD:409353 0/3 (0%)
Ig strand F 1524..1529 CDD:409353 2/8 (25%)
IG_like 1561..1640 CDD:214653 26/198 (13%)
Ig strand B 1567..1571 CDD:409353 1/3 (33%)
Ig strand C 1580..1584 CDD:409353 3/3 (100%)
Ig strand E 1605..1610 CDD:409353 2/4 (50%)
Ig strand F 1620..1625 CDD:409353 2/27 (7%)
Ig 1651..1732 CDD:472250 27/158 (17%)
Ig strand B 1660..1664 CDD:409353 0/11 (0%)
Ig strand C 1675..1679 CDD:409353 0/3 (0%)
Ig strand E 1698..1702 CDD:409353 3/14 (21%)
Ig strand F 1712..1717 CDD:409353 1/4 (25%)
Ig strand G 1725..1728 CDD:409353 0/2 (0%)
Ig 1752..1815 CDD:472250 7/62 (11%)
Ig strand B 1755..1759 CDD:409353 0/3 (0%)
Ig strand C 1768..1771 CDD:409353 0/2 (0%)
Ig strand E 1789..1793 CDD:409353 0/3 (0%)
Ig strand F 1802..1807 CDD:409353 1/4 (25%)
Ig 1826..1912 CDD:472250 6/32 (19%)
Ig strand B 1844..1848 CDD:409353 0/3 (0%)
Ig strand C 1857..1860 CDD:409353 264/1377 (19%)
Ig strand E 1878..1882 CDD:409353
Ig strand F 1892..1897 CDD:409353
Ig strand G 1905..1908 CDD:409353
Ig 1928..2002 CDD:472250
Ig strand B 1933..1937 CDD:409353
Ig strand C 1946..1950 CDD:409353
Ig strand E 1967..1971 CDD:409353
Ig strand F 1981..1986 CDD:409353
Ig strand G 1994..1997 CDD:409353
IG_like 2014..2095 CDD:214653
Ig strand B 2024..2028 CDD:409353
Ig strand C 2037..2041 CDD:409353
Ig strand E 2061..2065 CDD:409353
Ig strand F 2075..2080 CDD:409353
Ig strand G 2088..2091 CDD:409353
Ig_3 2098..2173 CDD:464046
Ig 2190..2283 CDD:472250
Ig strand C 2223..2227 CDD:409353
Ig strand E 2249..2253 CDD:409353
Ig strand F 2263..2268 CDD:409353
I-set 2296..2380 CDD:400151
Ig strand B 2306..2310 CDD:409353
Ig strand C 2319..2323 CDD:409353
Ig strand E 2346..2350 CDD:409353
Ig strand F 2360..2365 CDD:409353
Ig 2384..2471 CDD:472250
Ig strand B 2403..2407 CDD:409353
Ig strand C 2416..2420 CDD:409353
Ig strand E 2438..2443 CDD:409353
Ig strand F 2453..2458 CDD:409353
Ig strand G 2466..2469 CDD:409353
I-set 2477..2566 CDD:400151
Ig strand B 2496..2500 CDD:409353
Ig strand C 2509..2513 CDD:409353
Ig strand E 2532..2536 CDD:409353
Ig strand F 2546..2551 CDD:409353
Ig strand G 2559..2562 CDD:409353
Ig 2580..2654 CDD:472250
Ig strand B 2589..2592 CDD:409353
Ig strand C 2600..2604 CDD:409353
Ig strand E 2625..2632 CDD:409353
Ig strand F 2642..2647 CDD:409353
Ig_3 2665..2744 CDD:464046
IG_like 2768..2850 CDD:214653
Ig strand B 2778..2782 CDD:409353
Ig strand C 2792..2796 CDD:409353
Ig strand E 2816..2820 CDD:409353
Ig strand F 2830..2835 CDD:409353
I-set 2854..2939 CDD:400151
Ig strand B 2871..2875 CDD:409353
Ig strand C 2884..2888 CDD:409353
Ig strand E 2905..2909 CDD:409353
Ig strand F 2919..2924 CDD:409353
Ig strand G 2932..2935 CDD:409353
IG_like 2951..3031 CDD:214653
Ig strand B 2960..2964 CDD:409353
Ig strand C 2973..2977 CDD:409353
Ig strand E 2997..3001 CDD:409353
Ig strand F 3011..3016 CDD:409353
Ig strand G 3024..3027 CDD:409353
I-set 3046..3116 CDD:400151
Ig strand B 3053..3057 CDD:409353
Ig strand C 3066..3070 CDD:409353
Ig strand E 3089..3093 CDD:409353
Ig strand F 3103..3108 CDD:409353
I-set 3127..3213 CDD:400151
Ig strand B 3145..3148 CDD:409353
Ig strand C 3157..3161 CDD:409353
Ig strand E 3179..3183 CDD:409353
Ig strand F 3193..3198 CDD:409353
Ig 3217..3292 CDD:472250
Ig strand B 3234..3238 CDD:409353
Ig strand C 3247..3251 CDD:409353
Ig strand E 3263..3266 CDD:409353
Ig strand F 3276..3281 CDD:409353
Ig strand G 3289..3292 CDD:409353
I-set 3300..3386 CDD:400151
Ig strand B 3317..3321 CDD:409353
Ig strand C 3330..3334 CDD:409353
Ig strand E 3351..3356 CDD:409353
Ig strand F 3366..3371 CDD:409353
Ig strand G 3379..3382 CDD:409353
I-set 3396..3472 CDD:400151
Ig strand B 3408..3412 CDD:409353
Ig strand C 3421..3425 CDD:409353
Ig strand E 3443..3447 CDD:409353
Ig strand F 3457..3462 CDD:409353
I-set 3481..3569 CDD:400151
Ig strand B 3499..3503 CDD:409353
Ig strand C 3512..3516 CDD:409353
Ig strand E 3535..3539 CDD:409353
Ig strand F 3549..3554 CDD:409353
I-set 3591..3663 CDD:400151
Ig strand B 3592..3596 CDD:409353
Ig strand C 3605..3609 CDD:409353
Ig strand E 3629..3633 CDD:409353
Ig strand F 3643..3648 CDD:409353
Ig strand G 3656..3659 CDD:409353
Ig 3667..3762 CDD:472250
Ig strand B 3685..3689 CDD:409353
Ig strand C 3703..3707 CDD:409353
Ig strand E 3728..3732 CDD:409353
Ig strand F 3742..3747 CDD:409353
Ig 3775..3848 CDD:472250
Ig strand B 3785..3789 CDD:409353
Ig strand C 3798..3802 CDD:409353
Ig strand E 3820..3825 CDD:409353
Ig strand F 3835..3840 CDD:409353
Ig_3 3858..3934 CDD:464046
Ig 3968..4031 CDD:472250
Ig strand B 3970..3974 CDD:409353
Ig strand C 3983..3987 CDD:409353
Ig strand E 4007..4011 CDD:409353
Ig strand F 4021..4026 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.