DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and DHNAT1

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_175266.1 Gene:DHNAT1 AraportID:AT1G48320 Length:156 Species:Arabidopsis thaliana

Alignment Length:122 Identity:33/123 (27%)
Similarity:46/123 (37%) Gaps:25/123 (20%)


  Fly    23 GFE-SHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSKPCHPG--- 83
            ||| ..|...:|        |..|.|.......:|.||||     |..:...:|.|...|..   
plant    19 GFEFDELSPTRI--------TGRLPVSPVCCQPFKVLHGG-----VSALIAESLASMGAHMASGF 70

  Fly    84 ---VSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFID-----CTLKHKKDDLVIA 132
               ..:.||:|.|..|.|||.|..:|.....||.:...:     .|.|.|.:.::|:
plant    71 KRVAGIQLSINHLKSADLGDLVFAEATPVSTGKTIQVWEVKLWKTTQKDKANKILIS 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 29/114 (25%)
DHNAT1NP_175266.1 PLN02322 3..156 CDD:177956 33/123 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
10.910

Return to query results.
Submit another query.