DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and AT1G04290

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_563705.1 Gene:AT1G04290 AraportID:AT1G04290 Length:155 Species:Arabidopsis thaliana

Alignment Length:111 Identity:40/112 (36%)
Similarity:67/112 (60%) Gaps:3/112 (3%)


  Fly    30 KVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK-PCHPGVSVDLSVNFL 93
            ||.:::.|...|:  :|:....:|..||||||...||||||.:..:.:. ..|.||||:::|::|
plant    40 KVDLIEPGRIVCS--MKIPPHLLNAGKFLHGGATATLVDLIGSAVIYTAGASHSGVSVEINVSYL 102

  Fly    94 NGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKY 139
            :.|.|.:::.|::...:|||.:|.:...|:.|....:||:|.|.||
plant   103 DAAFLDEEIEIESKALRVGKAVAVVSVELRKKTTGKIIAQGRHTKY 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 39/111 (35%)
AT1G04290NP_563705.1 PaaI_thioesterase 38..148 CDD:239527 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41273
Inparanoid 1 1.050 74 1.000 Inparanoid score I2361
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoInspector 1 1.000 T32310
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.857 Consistency score
87.980

Return to query results.
Submit another query.