DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and AT1G04290

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_563705.1 Gene:AT1G04290 / 839552 AraportID:AT1G04290 Length:155 Species:Arabidopsis thaliana


Alignment Length:111 Identity:40/111 - (36%)
Similarity:67/111 - (60%) Gaps:3/111 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK-PCHPGVSVDLSVNFL 93
            ||.:::.|...|:  :|:....:|..||||||...||||||.:..:.:. ..|.||||:::|::|
plant    40 KVDLIEPGRIVCS--MKIPPHLLNAGKFLHGGATATLVDLIGSAVIYTAGASHSGVSVEINVSYL 102

  Fly    94 NGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKY 139
            :.|.|.:::.|::...:|||.:|.:...|:.|....:||:|.|.||
plant   103 DAAFLDEEIEIESKALRVGKAVAVVSVELRKKTTGKIIAQGRHTKY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 39/110 (35%)
AT1G04290NP_563705.1 PaaI_thioesterase 38..148 CDD:239527 38/109 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3869
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41273
Inparanoid 1 1.050 74 1.000 Inparanoid score I2429
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm3550
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.