DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and AT3G61200

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_191679.1 Gene:AT3G61200 AraportID:AT3G61200 Length:188 Species:Arabidopsis thaliana

Alignment Length:143 Identity:30/144 (21%)
Similarity:65/144 (45%) Gaps:14/144 (10%)


  Fly     9 EFAKHIT--EIINKSTGFES----HLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLV 67
            :|.|.|:  |..|..|.|:|    .....:.:....|..:..:.|.....|.:|.||||.:.::.
plant    43 DFFKAISPDESCNDFTSFDSFSVLFQNNTRALSIARGRVSCSVTVTPGISNFFKGLHGGAVASIA 107

  Fly    68 DLIT---TYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDL 129
            :.:.   ...::|:..|..:. :||:::|:.|.:..:::::..:.:.|:.|:.:....|.|:   
plant   108 ERVAMACVKTVVSEDKHLFIG-ELSMSYLSSAPISSELLVEGTVVRTGRNLSVVTVEFKIKE--- 168

  Fly   130 VIAKGTHLKYIKF 142
             ..|.|:|....|
plant   169 -TMKVTYLSRATF 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 21/112 (19%)
AT3G61200NP_191679.1 PaaI_thioesterase 72..181 CDD:239527 22/115 (19%)
4HBT_3 97..>180 CDD:290352 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1607235at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21660
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.