DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and AT3G16175

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_566538.1 Gene:AT3G16175 AraportID:AT3G16175 Length:157 Species:Arabidopsis thaliana

Alignment Length:127 Identity:36/128 (28%)
Similarity:60/128 (47%) Gaps:7/128 (5%)


  Fly    13 HITEII--NKSTGFESHLQK-VKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYA 74
            ::.||.  |..|.||..:.| ::::..|.|....:|.|....|......:.|.|..::|.|...|
plant    12 YLEEIAKGNGQTEFEILILKGLELIHVGKGILRCKLLVTDHVVGEDGSWNAGVITAVMDSIGASA 76

  Fly    75 LMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQA--NLSKVGKYLAFIDCTLKHKKDDLVIAKG 134
            :.|......:||||:.:|.:.||:.:.|.|:|  |.|..|...|.|:  ::.:....:||.|
plant    77 VYSSGGGLHISVDLNSSFYSTAKIHETVEIEARVNGSNGGLKSAVIE--IRRETSGEIIATG 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 29/107 (27%)
AT3G16175NP_566538.1 PaaI_thioesterase 32..141 CDD:239527 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1607235at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21660
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.