DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and AT2G29590

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_565683.1 Gene:AT2G29590 AraportID:AT2G29590 Length:158 Species:Arabidopsis thaliana

Alignment Length:134 Identity:37/135 (27%)
Similarity:65/135 (48%) Gaps:14/135 (10%)


  Fly    11 AKHITEIINKSTGFESHLQ----KVKIVDGGDGACTAELKV---DQDHVNLYKFLHGGYIMTLVD 68
            |..:.|.:.:...|..:..    :|..|:.|..:|:.::.:   |:|     |.|..|.|..|||
plant    21 APRVEEFLGEGKSFYENFSLRGIRVNRVEPGFISCSFKVPLRLTDRD-----KNLANGAIANLVD 80

  Fly    69 LITTYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQAN-LSKVGKYLAFIDCTLKHKKDDLVIA 132
            .:....:..:.....||||:|:.||:.||||:::.|.:. |.:.|.|...| ..:::|....:||
plant    81 EVGGALVHGEGLPMSVSVDMSIAFLSKAKLGEELEITSRLLGERGGYKGTI-VVVRNKMTGEIIA 144

  Fly   133 KGTH 136
            :|.|
plant   145 EGRH 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 34/111 (31%)
AT2G29590NP_565683.1 PaaI_thioesterase 42..151 CDD:239527 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2361
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1607235at2759
OrthoInspector 1 1.000 T32310
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21660
Phylome 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.