DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and them4

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_021322437.1 Gene:them4 ZFINID:ZDB-GENE-070112-982 Length:260 Species:Danio rerio

Alignment Length:88 Identity:23/89 (26%)
Similarity:43/89 (48%) Gaps:4/89 (4%)


  Fly    58 LHGGYIMTLVDLITTYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTL 122
            :|||.|.|::|.:|. .|......|.|:.:|::|:.:...||..|:|...|.::.....||.|.:
Zfish   157 VHGGAIATMIDTVTG-TLAGYLSGPSVTANLNINYRSPVPLGSVVIIHCALDRIEGRKTFITCKV 220

  Fly   123 KHKKDDLVIAKGT---HLKYIKF 142
            ....:..|..:.|   .::|:.:
Zfish   221 TSTDESKVYTEATADASIRYVLY 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 23/85 (27%)
them4XP_021322437.1 PaaI_thioesterase 136..234 CDD:239527 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.