DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and Acot13

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_080066.1 Gene:Acot13 MGIID:1914084 Length:140 Species:Mus musculus

Alignment Length:130 Identity:50/131 (38%)
Similarity:81/131 (62%) Gaps:1/131 (1%)


  Fly    12 KHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM 76
            :.:.:::.|..||:..|:||.:|.........|:||::.|.|....||||...||||.|:|.|||
Mouse     9 REVMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKLGTLHGGLTATLVDSISTMALM 73

  Fly    77 -SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
             ::...||||||:::.:::.||:|:::||.|::.|.||.|||....|.:|....:||:|.|.|::
Mouse    74 CTERGAPGVSVDMNITYMSPAKIGEEIVITAHILKQGKTLAFASVDLTNKTTGKLIAQGRHTKHL 138

  Fly   141  140
            Mouse   139  138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 45/110 (41%)
Acot13NP_080066.1 PaaI_thioesterase 28..138 CDD:239527 45/110 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142783874
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 1 1.000 H41273
Inparanoid 1 1.050 98 1.000 Inparanoid score I4969
Isobase 1 0.950 0 Normalized mean entropy S4138
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T617050
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.