DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and AT1G52191

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001117468.1 Gene:AT1G52191 AraportID:AT1G52191 Length:138 Species:Arabidopsis thaliana

Alignment Length:113 Identity:30/114 (26%)
Similarity:57/114 (50%) Gaps:12/114 (11%)


  Fly    28 LQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK-PCHPGVSVDLSVN 91
            |:.::::..|.|....:|.|....:|....||...|..|::|:...|:.|. ..|  .||||:.:
plant     6 LEGLQVIHVGRGIVRCKLTVTHHVLNEDGTLHTAAIGVLMELMGAIAIYSAGGSH--TSVDLNYS 68

  Fly    92 FLNGAKLGDDVVIQANLSKVGK-----YLAFIDCTLKHKKDDLVIAKG 134
            ..:.||:.:::.|:|.:  |||     ..|.|:  ::.:.::.:||.|
plant    69 LYSTAKIQEEIKIEARV--VGKRSENLNSAIIE--IRREYEEELIATG 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 29/111 (26%)
AT1G52191NP_001117468.1 PaaI_thioesterase 8..>89 CDD:239527 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1607235at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21660
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.