DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and acot13

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:XP_005159692.1 Gene:acot13 ZFINID:ZDB-GENE-060503-437 Length:146 Species:Danio rerio

Alignment Length:134 Identity:53/135 (39%)
Similarity:82/135 (61%) Gaps:1/135 (1%)


  Fly     8 LEFAKHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITT 72
            |...|.|...:..|.||:..|.||:::....|....|:||::.|.|....||||...||||:|:|
Zfish    11 LNTVKQIFRAMADSPGFDRVLSKVEVLSAAPGKVVCEMKVEEQHTNRGGTLHGGMTATLVDMIST 75

  Fly    73 YALM-SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTH 136
            .|:| |:...||||||:::.::|.||:|:|::|.|.:.|.|:.|||....|.:|.:..:||:|.|
Zfish    76 MAIMYSERGAPGVSVDMNITYMNAAKIGEDILITAQVLKQGRTLAFATVDLTNKANGKLIAQGRH 140

  Fly   137 LKYI 140
            .|::
Zfish   141 TKHL 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 45/110 (41%)
acot13XP_005159692.1 PaaI_thioesterase 31..144 CDD:239527 47/113 (42%)
4HBT_3 58..>141 CDD:290352 37/83 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142784981
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 1 1.000 H41273
Inparanoid 1 1.050 106 1.000 Inparanoid score I4830
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T597951
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.