DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and ACOT13

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_060943.1 Gene:ACOT13 HGNCID:20999 Length:140 Species:Homo sapiens

Alignment Length:130 Identity:51/131 (39%)
Similarity:81/131 (62%) Gaps:1/131 (1%)


  Fly    12 KHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM 76
            :.:.:.:.|:..||..|.|:.:|....|....|:||:::|.|....||||...||||.|:|.||:
Human     9 REVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALL 73

  Fly    77 -SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
             ::...||||||:::.:::.||||:|:||.|::.|.||.|||....|.:|....:||:|.|.|::
Human    74 CTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHL 138

  Fly   141  140
            Human   139  138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 46/110 (42%)
ACOT13NP_060943.1 PaaI_thioesterase 25..138 CDD:239527 48/113 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142784419
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 1 1.000 H41273
Inparanoid 1 1.050 98 1.000 Inparanoid score I4943
Isobase 1 0.950 0 Normalized mean entropy S4138
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T610248
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.