DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and acot13

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001005098.1 Gene:acot13 XenbaseID:XB-GENE-1004168 Length:141 Species:Xenopus tropicalis

Alignment Length:128 Identity:48/129 (37%)
Similarity:77/129 (60%) Gaps:1/129 (1%)


  Fly    14 ITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM-S 77
            |.:.:....||:..|.|:.:|....|....||:|:::|.|....||||...||||.::|.||: :
 Frog    12 IFKALGDGPGFDRVLSKLNLVSAAPGKVVCELQVEEEHTNRGGTLHGGLTATLVDTVSTVALLHT 76

  Fly    78 KPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
            :...||||||:::.::|.||:||.|:|.|.:.|.|:.|||....:.:|....:||:|.|.|::
 Frog    77 ERGAPGVSVDMNITYMNAAKIGDSVLITAQVLKQGRTLAFATVDVTNKVSGKLIAQGRHTKHL 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 43/110 (39%)
acot13NP_001005098.1 PaaI_thioesterase 31..139 CDD:239527 43/108 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142784585
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 1 1.000 H41273
Inparanoid 1 1.050 97 1.000 Inparanoid score I4778
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T602087
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.