DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and CG16985

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_647730.1 Gene:CG16985 FlyBaseID:FBgn0035355 Length:149 Species:Drosophila melanogaster

Alignment Length:143 Identity:63/144 (44%)
Similarity:91/144 (63%) Gaps:0/144 (0%)


  Fly     1 MGTRKKGLEFAKHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMT 65
            |..:|.|::|.|.::|..:.|.||:..|:.:||..||||....|..|..:|:|....||||...|
  Fly     1 MAAKKLGMDFVKQMSEYASGSNGFDRVLKMIKITGGGDGRAIGEFTVANEHLNRQGTLHGGLTAT 65

  Fly    66 LVDLITTYALMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLV 130
            :||..||||||||..||||:.:|:|:::..||.|:.:.|..|..:.||.:|::||.|:.|.|..:
  Fly    66 IVDNCTTYALMSKGSHPGVTANLNVSYIAAAKPGELIEIDCNTVRAGKKMAYLDCILRRKSDGKI 130

  Fly   131 IAKGTHLKYIKFD 143
            ||||..:|||:||
  Fly   131 IAKGGQVKYIQFD 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 50/109 (46%)
CG16985NP_647730.1 PaaI_thioesterase 31..140 CDD:239527 50/109 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142781538
eggNOG 1 0.900 E1_COG2050
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2361
Isobase 1 0.950 0 Normalized mean entropy S4138
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 P PTHR21660
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
98.870

Return to query results.
Submit another query.