DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and C25H3.3

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_872068.1 Gene:C25H3.3 / 353396 WormBaseID:WBGene00016112 Length:148 Species:Caenorhabditis elegans


Alignment Length:138 Identity:56/138 - (40%)
Similarity:78/138 - (56%) Gaps:7/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KGLEFAKHITEIINKST----GFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTL 66
            |.::.||.|  |.|..|    |..|....|:.|...:|....|.:|::|..|.:..||||...||
 Worm     4 KYMQLAKEI--IKNYGTKGQFGCVSGAGNVRAVHAEEGNLRVEFEVEKDQSNHFNTLHGGCTSTL 66

  Fly    67 VDLITTYA-LMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLV 130
            :|:.||.| |::||..|||||||.|.:|..||:|:.:|:.:.:.|.||.|||....|..|.|:::
 Worm    67 IDIFTTGALLLTKPARPGVSVDLHVTYLTAAKIGETLVLDSTVIKQGKTLAFTKAELYRKSDNVM 131

  Fly   131 IAKGTHLK 138
            ||.|.|.|
 Worm   132 IATGVHTK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 47/109 (43%)
C25H3.3NP_872068.1 PaaI_thioesterase 28..140 CDD:239527 47/112 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6286
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3667
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm14389
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - O PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.