DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and Acot13

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001099581.1 Gene:Acot13 RGDID:1306513 Length:140 Species:Rattus norvegicus

Alignment Length:130 Identity:49/131 (37%)
Similarity:82/131 (63%) Gaps:1/131 (1%)


  Fly    12 KHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM 76
            :.|.:::.|..||:..|:||.:|.........|:||::.|.|.:..||||...||||.|:|.|||
  Rat     9 REIMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKFGTLHGGLTATLVDSISTMALM 73

  Fly    77 -SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
             ::...||||:|:::.:::.||:|:::||.|::.|.|:.|||....|.:|....:||:|.|.|::
  Rat    74 CTERGAPGVSIDMNITYMSPAKIGEEIVITAHILKQGRTLAFASVDLTNKATGKLIAQGRHTKHL 138

  Fly   141  140
              Rat   139  138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 43/110 (39%)
Acot13NP_001099581.1 PaaI_thioesterase 28..138 CDD:239527 43/110 (39%)
4HBT_3 53..>121 CDD:290352 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142784350
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 1 1.000 H41273
Inparanoid 1 1.050 96 1.000 Inparanoid score I4875
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T619166
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.