DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and Acot13

DIOPT Version :10

Sequence 1:NP_647732.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001099581.1 Gene:Acot13 / 291135 RGDID:1306513 Length:140 Species:Rattus norvegicus


Alignment Length:130 Identity:49/130 - (37%)
Similarity:82/130 - (63%) Gaps:1/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALM 76
            :.|.:::.|..||:..|:||.:|.........|:||::.|.|.:..||||...||||.|:|.|||
  Rat     9 REIMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKFGTLHGGLTATLVDSISTMALM 73

  Fly    77 -SKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYI 140
             ::...||||:|:::.:::.||:|:::||.|::.|.|:.|||....|.:|....:||:|.|.|::
  Rat    74 CTERGAPGVSIDMNITYMSPAKIGEEIVITAHILKQGRTLAFASVDLTNKATGKLIAQGRHTKHL 138

  Fly   141  140
              Rat   139  138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_647732.1 PaaI_thioesterase 31..140 CDD:239527 43/109 (39%)
Acot13NP_001099581.1 PaaI_thioesterase 28..138 CDD:239527 43/109 (39%)

Return to query results.
Submit another query.