DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and SPBC31F10.02

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_596564.1 Gene:SPBC31F10.02 PomBaseID:SPBC31F10.02 Length:161 Species:Schizosaccharomyces pombe

Alignment Length:143 Identity:44/144 (31%)
Similarity:74/144 (51%) Gaps:6/144 (4%)


  Fly     2 GTRKKGLEFAKHITEIINKSTGFESH-LQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMT 65
            ||  |.|.|.:.:.:....:.||::| :..::|:....|.....||:.:.|:|....||||.|..
pombe     7 GT--KVLSFVRSVWQDFVNTNGFDAHVVSDIQIISAVPGFVECSLKLQKHHLNRMGNLHGGCIAA 69

  Fly    66 LVDLITTYALMSKPCH-PGVSVDLSVNFL-NGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDD 128
            |.||..:.||.|:... .|||:|::..|| :|..||..:::.|...::|..:||.........::
pombe    70 LTDLGGSLALASRGLFISGVSIDMNQTFLQSGGTLGSSILLHAKCDRLGSNIAFTSVDFLTSSNE 134

  Fly   129 LVIAKGTHLKYIK 141
             |.|||.|.|:::
pombe   135 -VFAKGRHTKFVR 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 36/111 (32%)
SPBC31F10.02NP_596564.1 PaaI_thioesterase 34..145 CDD:239527 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1911
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T631777
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.814 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.