DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and C25H3.14

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_495115.2 Gene:C25H3.14 WormBaseID:WBGene00016123 Length:143 Species:Caenorhabditis elegans

Alignment Length:136 Identity:45/137 (33%)
Similarity:75/137 (55%) Gaps:3/137 (2%)


  Fly     6 KGLEFAKHITEIINK--STGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVD 68
            |.::.||.:.::...  ..|:.:..:.|:.|...:|....|.:|::|..|.::.||||....|:|
 Worm     4 KYMQIAKEVIKMFGTKGQFGYAAGARNVRAVHAEEGNLRVEFEVEKDQTNQFETLHGGCTAALID 68

  Fly    69 LITTYA-LMSKPCHPGVSVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIA 132
            ..||.| |::|...|||||||.:.:|..|.:|:.:|:.:.:.|.|:.|.|....|..|:|:.:||
 Worm    69 CFTTGALLLTKEARPGVSVDLHITYLTAANIGETLVLNSTVIKQGRSLGFTKAELYRKRDNAMIA 133

  Fly   133 KGTHLK 138
            .|.|.|
 Worm   134 TGVHTK 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 41/110 (37%)
C25H3.14NP_495115.2 PaaI_thioesterase 31..140 CDD:239527 41/110 (37%)
4HBT_3 53..>140 CDD:290352 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2050
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3631
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T98076
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 O PTHR21660
Phylome 1 0.910 0.746 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.