DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16986 and F42H10.6

Sequence 1:NP_001189035.1 Gene:CG16986 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_498872.1 Gene:F42H10.6 WormBaseID:WBGene00018370 Length:169 Species:Caenorhabditis elegans

Alignment Length:124 Identity:45/125 (36%)
Similarity:65/125 (52%) Gaps:4/125 (3%)


  Fly    17 IINK---STGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK 78
            :.||   ||.|....:.|..|:........|:.|...|:|....||||...||.|:||..|:...
 Worm    27 VFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVVQHQHLNSKGTLHGGQTATLTDVITARAVGVT 91

  Fly    79 PCHPGV-SVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTH 136
            ....|: ||:|:|::|...|:||.:.|.|::.|||:.:||.||..:.|.|..:.|||.|
 Worm    92 VKDKGMASVELAVSYLLPVKVGDVLEITAHVLKVGRTMAFTDCEFRRKSDGKMSAKGKH 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 40/108 (37%)
F42H10.6NP_498872.1 PaaI_thioesterase 43..153 CDD:239527 40/109 (37%)
4HBT_3 69..>164 CDD:290352 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41273
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4138
OMA 1 1.010
OrthoDB 1 1.010 D1607235at2759
OrthoFinder 1 1.000 FOG0002656
OrthoInspector 1 1.000 T375043
orthoMCL 1 0.900 OOG5_129103
Panther 1 1.100 LDO PTHR21660
Phylome 1 0.910 0.654 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1714
TreeFam 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.