DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16986 and F42H10.6

DIOPT Version :9

Sequence 1:NP_001189035.1 Gene:CG16986 / 38325 FlyBaseID:FBgn0035356 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_498872.1 Gene:F42H10.6 / 176198 WormBaseID:WBGene00018370 Length:169 Species:Caenorhabditis elegans


Alignment Length:124 Identity:45/124 - (36%)
Similarity:65/124 - (52%) Gaps:4/124 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IINK---STGFESHLQKVKIVDGGDGACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSK 78
            :.||   ||.|....:.|..|:........|:.|...|:|....||||...||.|:||..|:...
 Worm    27 VFNKMKGSTNFNRVAEDVYPVEVTKSKLVCEMVVQHQHLNSKGTLHGGQTATLTDVITARAVGVT 91

  Fly    79 PCHPGV-SVDLSVNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTH 136
            ....|: ||:|:|::|...|:||.:.|.|::.|||:.:||.||..:.|.|..:.|||.|
 Worm    92 VKDKGMASVELAVSYLLPVKVGDVLEITAHVLKVGRTMAFTDCEFRRKSDGKMSAKGKH 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16986NP_001189035.1 PaaI_thioesterase 31..140 CDD:239527 40/107 (37%)
F42H10.6NP_498872.1 PaaI_thioesterase 43..153 CDD:239527 40/108 (37%)
4HBT_3 69..>164 CDD:290352 34/82 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2050
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41273
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4138
OMA 1 1.010 - - QHG55852
OrthoDB 1 1.010 - - D1607235at2759
OrthoFinder 1 1.000 - - FOG0002696
OrthoInspector 1 1.000 - - otm14389
orthoMCL 1 0.900 - - OOG6_101688
Panther 1 1.100 - - LDO PTHR21660
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1714
SonicParanoid 1 1.000 - - X2936
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.