DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12182 and GTF3C4

Sequence 1:NP_001286922.1 Gene:CG12182 FlyBaseID:FBgn0028504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_036336.2 Gene:GTF3C4 HGNCID:4667 Length:822 Species:Homo sapiens

Alignment Length:778 Identity:149/779 (19%)
Similarity:256/779 (33%) Gaps:245/779 (31%)


  Fly    53 GSKSEVITLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIYDSCDVLEAQHLALD 117
            |||:||  .|...|         |.|..|...::|..||.:.|.             |.:     
Human   121 GSKTEV--AECKEK---------FAASKDPTVSQTFMLDRVFNP-------------EGK----- 156

  Fly   118 PAYTAVCSVAVPPAR-LTAVKRAPK-LAANGNLLLGSLNTYGSLSLINKSAEYNRWNPVEGLNIA 180
                     |:||.| ......:|. ..|||..||.:|.....|::   .|..||...|:.:::.
Human   157 ---------ALPPMRGFKYTSWSPMGCDANGRCLLAALTMDNRLTI---QANLNRLQWVQLVDLT 209

  Fly   181 ETLRDTL-----------LPEVDIAKIKDFK---SYQEYINPAW----ITMFAWLPDDADATGQH 227
            |...:.|           .||.::....:|:   |.|..:...|    .|......::....|..
Human   210 EIYGERLYETSYRLSKNEAPEGNLGDFAEFQRRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSV 274

  Fly   228 VLVLGTAAGSL--WLLTLSADVKTLLS---------------------HQETKTSMGRICHIQAF 269
            :|.:....|::  |...|....|..:|                     |...|.|.         
Human   275 LLAVLFENGNIAVWQFQLPFVGKESISSCNTIESGITSPSVLFWWEYEHNNRKMSG--------- 330

  Fly   270 KDLLLVGDSNGLIHLYQLP-----AKGNTALALVKPLWEKADRMGLQMAVITEC-------PRMD 322
               |:||.:.|.|.:  ||     .||...|.....||::.|::.:..   .:|       .:..
Human   331 ---LIVGSAFGPIKI--LPVNLKAVKGYFTLRQPVILWKEMDQLPVHS---IKCVPLYHPYQKCS 387

  Fly   323 CYYITCCKAAHLLTWSMPRTGSTDCL----QARIYVGGMKITALCSLENSSYVA----GTAGSCL 379
            |..:...:.:::. |         ||    :|.:.|....:|.|.||...|..|    ||..:|.
Human   388 CSLVVAARGSYVF-W---------CLLLISKAGLNVHNSHVTGLHSLPIVSMTADKQNGTVYTCS 442

  Fly   380 SCVQI-----IHENNQLSLQMQSIAMG-VLQDFQVMGLCTSRHKNLMTLLLYR---------NKE 429
            |..::     |..:..|..:.|.|.:. |....:..|:..|.....:.::...         ||.
Human   443 SDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSPCGAYLAIITTEGMINGLHPVNKN 507

  Fly   430 YLNETVSQK--NQLVMQVLKVGNQDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKFMD 492
            |..:.|:.|  .:...|:|:...|:...|:              ||:..:|..:..:::..:|:.
Human   508 YQVQFVTLKTFEEAAAQLLESSVQNLFKQV--------------DLIDLVRWKILKDKHIPQFLQ 558

  Fly   493 FCPLDSIEFADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAMLNITHIR 557
            ......||     :.|.....:.|..:|:  |..||        :||:..|     |:...||..
Human   559 EALEKKIE-----SSGVTYFWRFKLFLLR--ILYQS--------MQKTPSE-----ALWKPTHED 603

  Fly   558 LRLQFIGS---------LSKRSPFQEQAIKCMFEEAHRL--INKLNDDF--TENHALGS------ 603
            .::..:.|         ..:.....:|.:|...:|..:.  :.:..||.  |...|.|.      
Human   604 SKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPTTGDAGGREPMEEK 668

  Fly   604 --TARTFVEQMGNHI--QHLHEMLG-------------IP-------VISNPQKQLHRCSVSFVE 644
              ..:..:|.:..|:  :|:..:||             ||       ::|:.:.......|....
Human   669 LLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEEYDDRTARVLIGH 733

  Fly   645 ISLSLERR----YCSLCNRQILFELDNLQELYESGR-----HLTCPVC----------HGSFA 688
            ||..:.::    :|||| ::||...|..|.:..:|.     .||...|          |.|.|
Human   734 ISKKMNKQTFPEHCSLC-KEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIA 795

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12182NP_001286922.1 zf-TFIIIC <637..687 CDD:289431 17/69 (25%)
GTF3C4NP_036336.2 TFIIIC_delta 65..254 CDD:315351 39/174 (22%)
zf-TFIIIC 745..817 CDD:315353 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119923at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.