DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12182 and AT3G49400

Sequence 1:NP_001286922.1 Gene:CG12182 FlyBaseID:FBgn0028504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_190509.2 Gene:AT3G49400 AraportID:AT3G49400 Length:892 Species:Arabidopsis thaliana

Alignment Length:711 Identity:130/712 (18%)
Similarity:224/712 (31%) Gaps:239/712 (34%)


  Fly   110 EAQHLALD----------------PAYTAVCSVAVPPARLTAVKRAPKLAAN------------- 145
            :|:|..|:                |.....||..:.|.  |.|.|...|:::             
plant   208 KAEHNVLEIEVYKQASNGQDRRSLPKALKKCSQEISPQ--TYVSREALLSSHSVAWSSLLRFSSE 270

  Fly   146 ---GNLLLGSLNTYGSLSLINKSAEYNRWNPVEGLNIAETLRDTLLPEVDIAKIKDFKSYQEYIN 207
               ||:|..||...||     ||...:.|. |.........|..:.|.|::..|....|      
plant   271 SSCGNMLRFSLLAIGS-----KSGSVSIWK-VHAPECYHIERSNVSPMVELTAIVQTHS------ 323

  Fly   208 PAWITMFAWLPDDADATG-QHVLVLGTAAGSLWLLTLSADVKTLLSHQET--------KTSMGRI 263
             :|::..:|.....|::. |.|||.|:..||         ||..:|::|.        |:|...:
plant   324 -SWVSTMSWGIFGCDSSNPQVVLVTGSCDGS---------VKIWMSNKEDLQNSVEVYKSSFFLL 378

  Fly   264 CHIQAFKDL-----------------LLVGDSNGLIHLYQLPAKGN---------------TALA 296
            ..:.|...:                 |.:|..:|...:::......               |.||
plant   379 KEVVAVNPVQVSTLSFVVSNHYNAMHLAIGKGSGSFEVWKCEISTRKFEQIVSTNAHNQVVTGLA 443

  Fly   297 LVKPLWEKADRMGLQMAVITECPRMDCYYITCCKAAHLLTW--------------SMPRTGST-- 345
                 |....|               |.| :|.:..::.:|              :.|...||  
plant   444 -----WSYDGR---------------CLY-SCSQDNYVRSWILCENAISEVPIPANTPGLSSTTD 487

  Fly   346 ------DCLQARIYVGGMKITAL----CSLENSSYVAGTAGSCLSCVQIIHENNQLSLQMQSIAM 400
                  .||...:..|.:.:..:    ..|.|..|   .|.|..:.|:.:....|.|.:.:....
plant   488 LPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMY---QARSQKAAVEFLWNGAQQSGESEDSTE 549

  Fly   401 GVLQDFQVMGLCTSRHKNLMTLLLYRNKE--YLNETVSQKNQLVMQVLKVGNQDPL---DQLVRH 460
            .|.:  .::|...:...|..:.:|:..||  |||:                   ||   |.:...
plant   550 TVTE--AILGFSKNEFANWESNILWSLKEFNYLNK-------------------PLVLWDMVAAM 593

  Fly   461 LESNKPMNHYTDLLAGLRLHV----FAEENWQKFMDFCPLDSIEFADTATEGQLQQLQIKFHVLQ 521
            |...:.|..:.:|:....|.|    |.::  ....|..|..:..|:|..:.        ..|:| 
plant   594 LAFKQSMPEFVELVLTKWLSVSYLGFHDD--ISMEDLVPKITKRFSDVPSR--------LLHIL- 647

  Fly   522 NVI-------RLQSSHLQLTVHIQKSRD--ELQLLLAMLNITHIRLRLQFIG-----------SL 566
            |||       .|::..:...:..|::.|  |:.|.|.:|..:...||.:.:|           |.
plant   648 NVISRRVMLSELKTEEINRKLQGQRTNDEGEIDLWLKLLQESERELRERLVGLSFSAYLLAESSQ 712

  Fly   567 SKRSP-----------FQEQAIKCMFEEAHRLINKLNDDF--TENHALGSTARTFVEQMGNHIQ- 617
            ...||           ..:|.::...:..|..:..|:.:.  :...:..||.....|:...:.. 
plant   713 GTISPPSWNWRPAGLALLQQWVEINRDIVHSQLETLSLEVKSSRTRSSNSTETALEEEKCPYCAA 777

  Fly   618 --HLHEMLGIPVISNPQK--------------QLHRCSVSFVEISLSLERRYCSLCNRQIL 662
              :.|........|:.||              :|.||.|| :::.......:|..|||..|
plant   778 PVNFHSAEEAFCESSHQKKKKSKDKERCDESHKLERCCVS-MQVCPPTPLWFCKCCNRMTL 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12182NP_001286922.1 zf-TFIIIC <637..687 CDD:289431 9/27 (33%)
AT3G49400NP_190509.2 TFIIIC_delta 15..161 CDD:289428
WD40 <275..463 CDD:295369 43/231 (19%)
WD40 <280..465 CDD:225201 42/228 (18%)
WD40 repeat 327..382 CDD:293791 15/64 (23%)
WD40 repeat 389..434 CDD:293791 3/45 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D966939at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.