DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12182 and Gtf3c4

Sequence 1:NP_001286922.1 Gene:CG12182 FlyBaseID:FBgn0028504 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001102943.1 Gene:Gtf3c4 RGDID:1592609 Length:818 Species:Rattus norvegicus

Alignment Length:784 Identity:150/785 (19%)
Similarity:253/785 (32%) Gaps:257/785 (33%)


  Fly    53 GSKSEVITLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIYDSCDVLEAQHLALD 117
            |||:||  .|...|         |.:..|...::|..||.:.|.             |.:     
  Rat   117 GSKTEV--AECKEK---------FASSKDPTISQTFMLDRMFNP-------------EGK----- 152

  Fly   118 PAYTAVCSVAVPPAR-LTAVKRAPK-LAANGNLLLGSLNTYGSLSLINKSAEYNRWNPVEGLNIA 180
                     |:||.| ......:|. ..|||..||.:|.....|::   ....||...|:.:::.
  Rat   153 ---------ALPPMRGFKYTSWSPMGCDANGRCLLAALTMDNRLTV---QVNLNRLQWVQLVDLT 205

  Fly   181 ETLRDTL-----------LPEVDIAKIKDFK---SYQEYINPAWITMFAWLP-----DDADATGQ 226
            |...|.|           .||.::....:|:   |.|..:...|.::.....     :..|.:..
  Rat   206 EIYGDRLYETSYRLSKNEAPEGNLGDFAEFQRRHSMQTPVRMEWSSICTTQQVKHNNECRDVSSV 270

  Fly   227 HVLVL---GTAAGSLWLLTLSADVKTLLS---------------------HQETKTSMGRICHIQ 267
            .:.||   |..|  :|...|....|..:|                     |...|.|.       
  Rat   271 LLAVLFENGNIA--VWQFQLPFVGKESISSCNTIESGISSPSVLFWWEYEHSNRKMSG------- 326

  Fly   268 AFKDLLLVGDSNGLIHLYQLP-----AKGNTALALVKPLWEKADRMGLQMAVITEC-------PR 320
                 |:||.:.|.:.:  ||     .||...|.....||::.|::.:..   .:|       .:
  Rat   327 -----LIVGSAFGPVKI--LPVNLKAVKGYFTLRQPVVLWKEMDKLPVHS---IKCVPLYHPYQK 381

  Fly   321 MDCYYITCCKAAHLLTWSMPRTGSTDCL----QARIYVGGMKITALCSLENSSYVA----GTAGS 377
            ..|..:...:.:::. |         ||    :|.:.|....:|.|.||...|..|    ||..:
  Rat   382 CSCSLVVAARGSYVF-W---------CLLLISKAGLNVHNSHVTGLHSLPIVSITADKQNGTVYT 436

  Fly   378 CLSCVQI-----IHENNQLSLQMQSIAMG-VLQDFQVMGLCTSRHKNLMTLLLYR---------N 427
            |.|..::     |..:..|..:.|.|.:. |....:..|:..|.....:.::...         |
  Rat   437 CSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSPCGAYLAIITTEGMVNGLHPVN 501

  Fly   428 KEYLNETVSQK--NQLVMQVLKVGNQDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKF 490
            |.|..:.|:.|  .:...|:|:...|:...|:              ||:..:|..:..:::..:|
  Rat   502 KNYQVQFVTLKTFEEAAAQLLESSVQNLFKQV--------------DLIDLVRWKILKDKHIPQF 552

  Fly   491 MDFCPLDSIEFADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAMLNITH 555
            :.......||     :.|.....:.|..:|:  |..||        :|||..|     |:...||
  Rat   553 LHEALEKKIE-----SSGVTYFWRFKLFLLR--ILYQS--------MQKSPSE-----ALWKPTH 597

  Fly   556 IRLRLQFIGS--------LSKRSPFQEQAIKCMFEEAHRLINKLNDDFTEN-----HALGSTA-- 605
            ...::..:.|        ..:.....:|..|...:|.    :|...|..|.     .|:|.|.  
  Rat   598 EDSKILLVDSPGMGDGEDEQQEEGTSKQGTKAGLQEK----SKEGGDTEETPEDSLTAVGDTGGR 658

  Fly   606 ----------RTFVEQMGNHI--QHLHEMLG-------------IP-------VISNPQKQLHRC 638
                      :..:|.:..|:  :|:..:||             ||       ::|:........
  Rat   659 EPIEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEDYDDRTA 723

  Fly   639 SVSFVEISLSLERR----YCSLCNRQILFELDNLQELYESGR-----HLTCPVC----------H 684
            .|....||..:.::    .|||| ::||...|..|.:..:|.     .||...|          |
  Rat   724 QVLIGHISKKMNKQTFPERCSLC-KEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLH 787

  Fly   685 GSFA 688
            .|.|
  Rat   788 DSIA 791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12182NP_001286922.1 zf-TFIIIC <637..687 CDD:289431 17/69 (25%)
Gtf3c4NP_001102943.1 TFIIIC_delta 61..250 CDD:289428 38/174 (22%)
zf-TFIIIC 741..813 CDD:289431 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119923at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.