DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12182 and gtf3c4

Sequence 1:NP_001286922.1 Gene:CG12182 FlyBaseID:FBgn0028504 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_021329082.1 Gene:gtf3c4 ZFINID:ZDB-GENE-041008-147 Length:770 Species:Danio rerio

Alignment Length:808 Identity:141/809 (17%)
Similarity:275/809 (34%) Gaps:262/809 (32%)


  Fly    42 SDSDGDFIALSGSKSEVI---TLELSSKFMVVDPFPYFVAIYDSNAAETRPLDVLANKVDLVAIY 103
            |..:.||.|  |....|:   .::|.|....|:|..:        |.:.|......|.|.|:.:.
Zfish    21 SGPEDDFWA--GQGPIVLRDPAIKLLSPVSGVEPLSW--------AEDHRLAACNTNSVSLIELV 75

  Fly   104 DSCDVLE-AQHLALD----PAYTAVCSVAVPPAR-LTAVKRAPKLAANG---------------N 147
              ||:.. :|:|.|.    |..|..|.:.|...: :.|||.:   .||.               |
Zfish    76 --CDIHSLSQNLVLHRTHIPVPTTTCELKVGSEKDVRAVKES---FANSKDPVVSQMIMIDRVIN 135

  Fly   148 LLLGSLNTYGSLSLINKSAEYNRWNPV----------------EGLNIAET---LRDTLLPEVDI 193
            ...|.|:          ..:|..|:|:                ..|.|..:   |:.|||  :|:
Zfish   136 PQCGPLH----------GVKYTSWSPLGCDKLGRCLLAFLTLDNRLTIHSSHLQLQWTLL--LDL 188

  Fly   194 AKI----------------------KDFKSYQEY------INPAWITMFAWLPDDADATGQHV-- 228
            .::                      |||...|..      :...|.::.:.....:|...:.:  
Zfish   189 TELYGEMLKTRKYSAQNDGTPPVSFKDFDELQRRFRMQTPVRMEWSSLCSMQQVQSDNAHKDINT 253

  Fly   229 ----LVLGTAAGSLWLLTLSADVK-TLLSHQETKTSMG--------RICHIQAFKDLLLVGDSNG 280
                :::......:|..:|..:.| :::|....|:.:.        :..|.......|::|.|.|
Zfish   254 VLLAVLMENGDVVVWQFSLPLNGKESVVSCSTIKSGVSSPSALTWWQYEHSGRKMSGLIIGSSVG 318

  Fly   281 LIHLYQLP-----AKGNTALALVKPLWEKADRMGLQ----MAVITECPRMDCYYITCCKAAHLLT 336
            .:.:  ||     .||...|.....||:::|::.:.    :.:.....:.:|..:...:..::. 
Zfish   319 PVKI--LPVNIKAVKGYFTLRQPVVLWQESDQIPVHNIKCITLFHPHQKCNCSLVVAARGPYIF- 380

  Fly   337 WSMPRTGSTDCL----QARIYVGGMKITALCSLENSSYVAGTA----GSCLSCVQIIHENNQLSL 393
            |         ||    :|.:.|....||   .|.::..::.||    |:.|:| .:..:..:|:.
Zfish   381 W---------CLLLISKAGLNVHNSHIT---GLHSTPIISMTACHNNGTVLTC-SLDGKVKKLTT 432

  Fly   394 QMQSIAMGVLQDFQVM--GLCTSRHKNLMTLLLYRNKEYL----NETVS---QKNQLVMQVLKVG 449
            ....:|:...|:..|:  |:...|   :..:.:..|..||    ||.::   ....|..||..:.
Zfish   433 VFTDLAVEFKQEEIVLPEGVAGRR---IHGISISPNSAYLAVLSNEGMNNGFHPVALNYQVQFIT 494

  Fly   450 NQDPLDQLVRHLESNKPMNHYTDLLAGLRLHVFAEENWQKFMDFCPLDSIEFADTATEGQLQQLQ 514
            .:.|.:...:.|:::....: :|||..||..:..:::               ..:|.|..|::  
Zfish   495 FKTPDEAAAKMLDAHSLFRN-SDLLDLLRWRILKDKS---------------IPSAYENNLEE-- 541

  Fly   515 IKFHVLQNVIRLQSSHLQLTVHIQKSRDELQLLLAMLNITHI-RLRLQFIGSLSKRSPFQEQAIK 578
                      :||:|                      ..|:: ||:|.|:.:|.|  ..|:...:
Zfish   542 ----------KLQTS----------------------GSTYLWRLKLFFLRTLHK--SMQKTPSE 572

  Fly   579 CMFEEAHRLINKL-----------NDDFTENHALGSTARTFVEQM---GNHI---------QHLH 620
            .:::...|....|           .|:..|:....:..|...|:|   |:.|         :::.
Zfish   573 ALWQPRRRSGQSLVGDGDEGGGGDEDEMMEDRQGDAEIREREERMKEIGSRIEAVESHLIRENMK 637

  Fly   621 EMLG-------------IP-------VISNPQKQLHRCSVSFVEISLSLERR----YCSLCNRQI 661
            ::||             :|       :.::|..:.....|....|...:.::    ||:||...:
Zfish   638 KVLGEVYLHTCVTQNTRVPTKGVCDFLTNDPANEDRAAKVLIGHIMNKMNKQTFPEYCALCKEIL 702

  Fly   662 LFELDNLQELYESGRHLTCPV----CHG 685
            .|......|.....|.|.|.:    |.|
Zfish   703 PFTDCKRAECKNGHRWLRCALSYQACQG 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12182NP_001286922.1 zf-TFIIIC <637..687 CDD:289431 13/58 (22%)
gtf3c4XP_021329082.1 TFIIIC_delta 48..234 CDD:315351 39/211 (18%)
zf-TFIIIC 693..765 CDD:315353 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119923at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.