DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12182 and gtf3c4

Sequence 1:NP_001286922.1 Gene:CG12182 FlyBaseID:FBgn0028504 Length:694 Species:Drosophila melanogaster
Sequence 2:XP_002936231.1 Gene:gtf3c4 XenbaseID:XB-GENE-987995 Length:775 Species:Xenopus tropicalis

Alignment Length:427 Identity:80/428 (19%)
Similarity:134/428 (31%) Gaps:169/428 (39%)


  Fly   401 GVLQDFQVMGLCTSRHKNLMTLLLYRNKEY----------LNETVSQKNQL------------VM 443
            |..|:..:...|.....:..||.:.:.||.          ...||||...|            ..
 Frog    67 GCSQELTLHRTCVPAPASTCTLKVGKEKEVEDCKEMFARSKTLTVSQSFMLDRVFNPEGKFLPSF 131

  Fly   444 QVLKVGNQDPL----------------DQLVRHLESNKPMNHYTDLLAGLRL---HVFAEENWQK 489
            |..|..:..|:                ::|..|...|:  .|:..|:....|   |:| |.|::.
 Frog   132 QGFKYASWSPIGCDANGRCLVAALTLDNRLTIHANINR--LHWRQLVDLTELYGQHLF-ESNYRV 193

  Fly   490 FMDFCPLDSIEFADTATEGQLQQLQIKFHVLQNVIRLQSSHLQLTVHIQKSR---DELQLLLAML 551
            ..|..|...:   |..||.:      :.|.:|..:|::.|.:.::..|.::.   |:..:|||:|
 Frog   194 SGDETPHAGL---DDFTEFK------RRHSMQTPVRMEWSGICISQQITENNECVDQSTVLLAVL 249

  Fly   552 ----NITHIRLRLQFIGSLS-----------------------------------------KRSP 571
                ::...:|||.|:|..|                                         |..|
 Frog   250 FENGDVAVWQLRLPFLGKESITSCNTIVSGISSPSVLAWWEYEHSNRKMSGLIIGSRLGPIKIIP 314

  Fly   572 FQEQAIKCMFEEAHRLINKLNDDFTENH----------------ALGSTAR--------TFVEQM 612
            ...:|:|..|.....:|.....|....|                :|...||        ..:.:.
 Frog   315 VNLKAVKGYFTLRQPVILWQEADLLPVHGIKCIGLYHPYQNCRCSLVVAARGCYLFWCLLLISKA 379

  Fly   613 G-----NHIQHLHEMLGIPVIS-NPQKQ---LHRCSVS---------FVEISLSLERRYCSLCNR 659
            |     :|:..||   .:|:|| :..||   ::.|||.         |.|::|..|.        
 Frog   380 GLNVHNSHVTGLH---SLPIISMSVDKQNGTIYTCSVDGKVQQLIPIFTEVALKFEH-------- 433

  Fly   660 QILFELDNLQELY-----------ESGRHLTCPVCHG 685
                :|.||.:::           ..|.:|.|....|
 Frog   434 ----QLINLSDMFGPVKSHAITVSPGGAYLACITTEG 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12182NP_001286922.1 zf-TFIIIC <637..687 CDD:289431 14/70 (20%)
gtf3c4XP_002936231.1 TFIIIC_delta 35..224 CDD:289428 33/169 (20%)
zf-TFIIIC 698..770 CDD:289431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D119923at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.