DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP704B1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_177109.3 Gene:CYP704B1 AraportID:AT1G69500 Length:524 Species:Arabidopsis thaliana

Alignment Length:575 Identity:147/576 (26%)
Similarity:244/576 (42%) Gaps:121/576 (21%)


  Fly     1 MWLTLITGALILLLTWDF-GRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGE-- 62
            |.|.|:...::  .:|.| .|..||    .||   ||.:.|::|..::.| ...:.:..|:.|  
plant     1 MSLCLVIACMV--TSWIFLHRWGQR----NKS---GPKTWPLVGAAIEQL-TNFDRMHDWLVEYL 55

  Fly    63 ----------KFDKYGKTFRFWILGESLIYTKDLQYFETILSST-TLLEKGQLY-EYLRPFLNDG 115
                      .|..|             .|..|....|.:|.:. :...||:.| .|:...|.||
plant    56 YNSRTVVVPMPFTTY-------------TYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDG 107

  Fly   116 LLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGK-TAVDMLKYVSLAAL 179
            :..|.|..|..:||..:..|..|.|..:..::.:..|:.:..:...|..| ..|||.:.:....|
plant   108 IFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQELLMRMTL 172

  Fly   180 DVITEAAMGVQVN--AQNDPDFPYIKA------LKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHR 236
            |.|.:...||::.  |...|:..:.||      :.::.:|.|  :::..:..|    :.:..|  
plant   173 DSICKVGFGVEIGTLAPELPENHFAKAFDTANIIVTLRFIDP--LWKMKKFLN----IGSEAL-- 229

  Fly   237 QLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEI------GSKSQMALLDILLQ-S 294
             |...|:|::|||..||       ||.||:       |.:|:|      .:.:.....|||.: .
plant   230 -LGKSIKVVNDFTYSVI-------RRRKAE-------LLEAQISPTNNNNNNNNKVKHDILSRFI 279

  Fly   295 SINNQPLS---DADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASA 356
            .|::.|.|   :..:|:.|..|:..|.|||::.::.|:|.|..:..|.::::.|||.:....|.|
plant   280 EISDDPDSKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQELEKESAEA 344

  Fly   357 PVTQAQLQD-------------------------LKYLDCVIKETMRLYPPVPAIGRHAQKELEI 396
            ..|.....|                         |.||..||.||:||||.||   :..:..|| 
plant   345 TNTSLHQYDTEDFNSFNEKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVP---QDPKGVLE- 405

  Fly   397 GDKTIPANTSI-------YLVLYYAHRDANYFPDPLSFRPERFLEDQE-QGHNTFAYVPFSAGPK 453
             |..:|..|.:       |:.......:.|:..|...|:|||:|:|.. |..:.|.:..|.|||:
plant   406 -DDMLPNGTKVKAGGMVTYVPYSMGRMEYNWGSDAALFKPERWLKDGVFQNASPFKFTAFQAGPR 469

  Fly   454 NCIGQKFAVLEMKVLISKVLRFYE--LLPLGEELKPMLNFILRSASGINVGLRPR 506
            .|:|:..|.|:||:.::.:.|||:  |:| ...:|..:..||..|.|:.|.:..|
plant   470 ICLGKDSAYLQMKMAMAILCRFYKFHLVP-NHPVKYRMMTILSMAHGLKVTVSRR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 132/527 (25%)
CYP704B1NP_177109.3 PLN03195 1..524 CDD:215627 147/576 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 1 1.000 T32115
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.