DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP86C1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_173862.1 Gene:CYP86C1 AraportID:AT1G24540 Length:522 Species:Arabidopsis thaliana

Alignment Length:519 Identity:135/520 (26%)
Similarity:221/520 (43%) Gaps:87/520 (17%)


  Fly    35 GPISIPILGCGLQALHLGAENIIGWVGEKFDKYGKTFRF---WILGESLIYTKDLQYFETILSST 96
            ||:..|:||. :..|.|...::..|......:.|.||.:   |..|...|.|.|....|.||.:.
plant    42 GPVMWPVLGI-IPMLALNKHDLFTWCTRCVVRSGGTFHYRGIWFGGAYGIMTADPANVEHILKTN 105

  Fly    97 -TLLEKGQLY-EYLRPFLNDGLLVSTGRKWHARRKIFTHAFH-FKVLEH-YVEIMDRHSSVMVDN 157
             ....||..| |..|..|.||:..:....|...|::.....| .:.||| :..:.|.....:|..
plant   106 FKNYPKGAFYRERFRDLLEDGIFNADDELWKEERRVAKTEMHSSRFLEHTFTTMRDLVDQKLVPL 170

  Fly   158 LRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQND--PDFPYIKALKSVVYIQPDRMFRFS 220
            :..::..|...|:...:.....|.|..:|.||...:...  |:.|:.||            |..:
plant   171 MENLSTSKRVFDLQDLLLRFTFDNICISAFGVYPGSLETGLPEIPFAKA------------FEDA 223

  Fly   221 RRYNWLFPLAAPLL-----------HRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSL 274
            ..|.....|..|.:           .|:|.:.:|::|.|.:|.:.|||..:|:            
plant   224 TEYTLARFLIPPFVWKPMRFLGIGYERKLNNAVRIVHAFANKTVRERRNKMRK------------ 276

  Fly   275 GDAEIGSKSQMA-LLDILLQSSINNQP-------LSDADIREEVDTFMFEGDDTTSSGVSHALYA 331
                :|:.:..| ||..|:|.....:.       .||...||...:|:..|.||||..:....:.
plant   277 ----LGNLNDYADLLSRLMQREYEKEEDTTRGNYFSDKYFREFCTSFIIAGRDTTSVALVWFFWL 337

  Fly   332 IARHPEVQQRI---FEELQRVLGPDASAPVTQAQ-LQDLKYLDCVIKETMRLYPPVPAIGRHAQK 392
            :.:||||::||   ..|::|.|....:....:|: .:::.||...:.|::||||.||...:.|  
plant   338 VQKHPEVEKRILREIREIKRKLTTQETEDQFEAEDFREMVYLQAALTESLRLYPSVPMEMKQA-- 400

  Fly   393 ELEIGDKTIPANTSI-------YLVLYYAHRDANYFPDPLSFRPERFL-------EDQEQGHNTF 443
               :.|..:|..|.:       |.|......::.:..|...|:|||::       |||      |
plant   401 ---LEDDVLPDGTRVKKGARIHYSVYSMGRIESIWGKDWEEFKPERWIKEGRIVSEDQ------F 456

  Fly   444 AYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYEL-LPLGEELKPMLNFILRSASGINVGLRPR 506
            .||.|:.||:.|:|:|||..:||::.:.:|..|.: :..|:|:.|.|...|...:|:||.|:||
plant   457 KYVVFNGGPRLCVGKKFAYTQMKMVAAAILMRYSVKVVQGQEIVPKLTTTLYMKNGMNVMLQPR 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 128/505 (25%)
CYP86C1NP_173862.1 p450 90..520 CDD:299894 121/469 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 1 1.000 T32115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.