DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP72C1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana

Alignment Length:311 Identity:64/312 (21%)
Similarity:108/312 (35%) Gaps:83/312 (27%)


  Fly     6 ITGALILLLTW----------------------DFGRKRQRVLAFE----------KSAIPGPIS 38
            :.|.|||:|.|                      .|.....|:|..:          ..::|.|:.
plant    12 LIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLPLD 76

  Fly    39 IPILGCGLQALHLGAENIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQ 103
            ...|...:..||   ..::        |:||....|......:...|.:....|:|...|..|.:
plant    77 ADFLPRMMPFLH---HTVL--------KHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPK 130

  Fly   104 LYEYLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAV 168
            :..:...||: |||...|.||...|.|...||....|:..:...:.....|::...::|..|..:
plant   131 IGSHNHVFLS-GLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTM 194

  Fly   169 DMLKYVSLAAL--DVITEAAMG-----------VQVNAQNDPDFPYIKALKSVVYIQPDRMF--- 217
            ::..:.....|  :::..|:.|           :| ..|.|.....|:|    ||| |...|   
plant   195 ELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQ-QEQIDLGLLAIRA----VYI-PGSKFLPT 253

  Fly   218 RFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGT 268
            :|:||.            |:...|:|.|.   ..:|..:.|.::|.:  ||
plant   254 KFNRRL------------RETERDMRAMF---KAMIETKEEEIKRGR--GT 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 55/252 (22%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.