DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP94B3

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_190421.1 Gene:CYP94B3 AraportID:AT3G48520 Length:506 Species:Arabidopsis thaliana

Alignment Length:542 Identity:128/543 (24%)
Similarity:233/543 (43%) Gaps:97/543 (18%)


  Fly    10 LILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGEKFD-KYGKTFRF 73
            |..|:|..|..........:::...||.|.|::| .:.:.:.....::.|..|... ...:|...
plant    10 LAFLITIIFFLSSSSTKKVQENTTYGPPSYPLIG-SILSFNKNRHRLLQWYTELLRLSPSQTILV 73

  Fly    74 WILG--ESLIYTKDLQYFETILSSTTL-LEKGQLY-EYLRPFLNDGLLVSTGRKWHARRKIFTHA 134
            .:||  .::|.|..|. .|.||.:... ..||:.: :.|...|..|:....|..|.::||:.:|.
plant    74 PLLGNRRTIITTNPLN-VEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHE 137

  Fly   135 FHFKVLEHYV-EIM-DRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQNDP 197
            |..:.|..:. |:: |...:.:|..|...||..|.||:...:...|.||:.:.::|.      ||
plant   138 FSTRSLRSFAFEVLKDEVENRLVPVLSTAADVGTTVDLQDVLKRFAFDVVCKVSLGW------DP 196

  Fly   198 DF--------PYIKALKSVVYIQPDR-------MFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHD 247
            |.        |.::|..:...|...|       :::..|..|    :.:   .|:|...||.:|.
plant   197 DCLDLTRPVNPLVEAFDTAAEISARRATEPIYAVWKTKRVLN----VGS---ERKLREAIRTVHV 254

  Fly   248 FTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEVDT 312
            ...:::        |||.    :.|.:|   .|::::..||...|.:..|.:.     :|:.|.:
plant   255 LVSEIV--------RAKK----KSLEIG---TGAEAKQDLLSRFLAAGHNGEA-----VRDMVIS 299

  Fly   313 FMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETM 377
            |:..|.||||:.::...:.:..:.:|:::|.||:.    |..|..:....|:::.|....:.|.|
plant   300 FIMAGRDTTSAAMTWLFWLLTENDDVERKILEEVD----PLVSLGLGFEDLKEMAYTKACLCEAM 360

  Fly   378 RLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRD-ANYFP------------DPLSFRP 429
            ||||||....:||     ..|..:|..|.:      ...| ..|||            |...|.|
plant   361 RLYPPVSWDSKHA-----ANDDVLPDGTRV------KRGDKVTYFPYGMGRMETLWGTDSEEFNP 414

  Fly   430 ERFLEDQEQGH--------NTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELK 486
            .|:. |.|.|.        :.:.:..|.|||:.|:|::.|.::||.::..||..:|::|:.:: :
plant   415 NRWF-DSEPGSTRPVLKPISPYKFPVFQAGPRVCVGKEMAFMQMKYVVGSVLSRFEIVPVNKD-R 477

  Fly   487 PMLNFILRS--ASGINVGLRPR 506
            |:...:|.:  |.|:.|.::.|
plant   478 PVFVPLLTAHMAGGLKVKIKRR 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 119/502 (24%)
CYP94B3NP_190421.1 p450 46..501 CDD:299894 119/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 1 1.000 T32115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.