DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP72A13

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_188084.1 Gene:CYP72A13 AraportID:AT3G14660 Length:512 Species:Arabidopsis thaliana

Alignment Length:523 Identity:124/524 (24%)
Similarity:215/524 (41%) Gaps:102/524 (19%)


  Fly    11 ILLLTWDFGRKRQRVLA--------FEKSAIPGPISIPILGCGLQALHLGAE------------- 54
            :::::|...|..|||..        ..:..:.|....|::|...:...:.||             
plant    14 VVVVSWWVWRTLQRVWLKPKMLESYLRRQGLAGTPYTPLVGDLKRNFSMLAEARSKPINLTDDIT 78

  Fly    55 -NIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLV 118
             .|:.:..:....:|:||..|......|...|.:..:.:.:.....:|...:. |...:..||:.
plant    79 PRIVPYPLQMLKTHGRTFFTWFGPIPTITIMDPEQIKEVFNKVYDFQKAHTFP-LGRLIAAGLVS 142

  Fly   119 STGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTA---VDMLKYVSLAALD 180
            ..|.||...|:|...|||.:.:::.|....:..|.:|....|:...|.:   ||:..::.....|
plant   143 YDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSEIVGEWDKLVTDKQSSCEVDIWPWLVSMTAD 207

  Fly   181 VITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSR------------------RYNWLF 227
            ||:..|.|..                   |.:..|:|....                  ||   |
plant   208 VISRTAFGSS-------------------YKEGQRIFELQAELAQLIIQAFRKAIIPGYRY---F 250

  Fly   228 PLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILL 292
            |...   :|::.:..|.:......::::|    .||:             |.|......||.|||
plant   251 PTKG---NRRMKAAAREIKFILRGIVNKR----LRAR-------------EAGEAPSDDLLGILL 295

  Fly   293 QSSI---NNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLG--- 351
            :|::   ....:|..::.||...|.|.|.:||:..:...:..:::|.:.|.|..||:::|.|   
plant   296 ESNLGQTKGNGMSTEELMEECKLFYFAGQETTTVLLVWTMVLLSQHQDWQARAREEVKQVFGDKE 360

  Fly   352 PDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHR 416
            |||..      |..||.:..::.|.:||||||..:.|...||:::||.|:|....|.|.:....|
plant   361 PDAEG------LNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMQLGDLTLPGGVQISLPILLIQR 419

  Fly   417 DANYF-PDPLSFRPERFLEDQEQG-HNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLR--FYE 477
            |...: .|...|:|:||.:...:. .|..::.||:.||:.||||.||:||.|:.::.:||  .:|
plant   420 DRELWGNDAGEFKPDRFKDGLSKATKNQVSFFPFAWGPRICIGQNFALLEAKMAMTLILRKFSFE 484

  Fly   478 LLP 480
            |.|
plant   485 LSP 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 119/493 (24%)
CYP72A13NP_188084.1 p450 24..512 CDD:299894 122/514 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.