DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP709B1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_566092.1 Gene:CYP709B1 AraportID:AT2G46960 Length:519 Species:Arabidopsis thaliana

Alignment Length:480 Identity:124/481 (26%)
Similarity:208/481 (43%) Gaps:84/481 (17%)


  Fly    59 WVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTT--LLEKGQLYEYLRPFLNDGLLVSTG 121
            |:.:    ||:||.:|...|..|...|.:..:|:||:..  .::.....|.::...:.||:...|
plant    88 WMSQ----YGETFLYWNGTEPRICISDPELAKTMLSNKLGFFVKSKARPEAVKLVGSKGLVFIEG 148

  Fly   122 RKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRK------VADGKTAVDMLKYVSLAALD 180
            ..|...|:|...||....|:....:|...:..|::..||      ....|...:|.:.......|
plant   149 ADWVRHRRILNPAFSIDRLKIMTTVMVDCTLKMLEEWRKESTKEETEHPKIKKEMNEEFQRLTAD 213

  Fly   181 VITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFR----FSRRYNW-LFPLAAPLLHRQLL- 239
            :|..:|.|..                   |::...:||    ..|.|.. |..::.|  ..|.| 
plant   214 IIATSAFGSS-------------------YVEGIEVFRSQMELKRCYTTSLNQVSIP--GTQYLP 257

  Fly   240 --SDIRV------MHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQ--- 293
              |:|||      |.:...::||.|.:    :|:|       .||         .||.|||:   
plant   258 TPSNIRVWKLERKMDNSIKRIISSRLQ----SKSD-------YGD---------DLLGILLKAYN 302

  Fly   294 SSINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLG----PDA 354
            :....:.:|..:|..|..||.|.|.:|||:.::.....::.|.:.|:::.||:.:..|    ||:
plant   303 TEGKERKMSIEEIIHECRTFFFGGHETTSNLLAWTTMLLSLHQDWQEKLREEIFKECGKEKTPDS 367

  Fly   355 SAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDAN 419
            ..      ...||.::.||.|::|||.||.|:.|.|...:::||..||..|::.:.|...|.|..
plant   368 ET------FSKLKLMNMVIMESLRLYGPVSALAREASVNIKLGDLEIPKGTTVVIPLLKMHSDKT 426

  Fly   420 YF-PDPLSFRPERFLEDQEQGHN-TFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLG 482
            .: .|...|.|.||.....:..| ..|.:.||.||:.||||.|.::|.|.:::.:|:.:..:.|.
plant   427 LWGSDADKFNPMRFANGVSRAANHPNALLAFSVGPRACIGQNFVMIEAKTVLTMILQRFRFISLC 491

  Fly   483 EELK--PMLNFILRSASGINVGLRP 505
            :|.|  |:.|..::...|:.|.|:|
plant   492 DEYKHTPVDNVTIQPQYGLPVMLQP 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 120/467 (26%)
CYP709B1NP_566092.1 p450 32..517 CDD:299894 124/481 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.