DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP704A2

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_182075.1 Gene:CYP704A2 AraportID:AT2G45510 Length:511 Species:Arabidopsis thaliana

Alignment Length:461 Identity:118/462 (26%)
Similarity:205/462 (44%) Gaps:46/462 (10%)


  Fly    70 TFRFWILGESLIYTKDLQYFETILSST-TLLEKG-QLYEYLRPFLNDGLLVSTGRKWHARRKIFT 132
            |:||...|:|.|.|.|.:..|.||.:. ....|| ...|.:...|..|:....|.||..:||:.:
plant    70 TYRFLSPGQSEILTADPRNVEHILKTRFDNYSKGHSSRENMADLLGHGIFAVDGEKWRQQRKLSS 134

  Fly   133 HAFHFKVLEHY-VEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVN---- 192
            ..|..:||..: ..:..|::|.:|..:.:.|....|.|....:....||.|.:...||::.    
plant   135 FEFSTRVLRDFSCSVFRRNASKLVGFVSEFALSGKAFDAQDLLMRCTLDSIFKVGFGVELKCLDG 199

  Fly   193 -AQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISER 256
             ::...:|  ::|..........|......:..|.|.:.:   ..:|...|..:..|...:|:.:
plant   200 FSKEGQEF--MEAFDEGNVATSSRFIDPLWKLKWFFNIGS---QSKLKKSIATIDKFVYSLITTK 259

  Fly   257 RETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTT 321
            |:.:  ||...|.            ..:..|...|::|..:.:.::|..:|:.:..||..|.|||
plant   260 RKEL--AKEQNTV------------VREDILSRFLVESEKDPENMNDKYLRDIILNFMIAGKDTT 310

  Fly   322 SSGVSHALYAIARHPEVQQRIFEELQRVL-----GPDASA---PVTQAQLQDLKYLDCVIKETMR 378
            ::.:|..||.:.::|.||::|.:|::.|.     ..|.:.   .:.:..|.::.||...:.||:|
plant   311 AALLSWFLYMLCKNPLVQEKIVQEIRDVTFSHEKTTDVNGFVESINEEALDEMHYLHAALSETLR 375

  Fly   379 LYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDANYF--PDPLSFRPERFLED-QEQG 439
            ||||||...|.|:.:..:.| ..:....:||.:.|...| ..|.  .|...|:|||:|:| ..|.
plant   376 LYPPVPVDMRCAENDDVLPDGHRVSKGDNIYYIAYAMGR-MTYIWGQDAEEFKPERWLKDGLFQP 439

  Fly   440 HNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEE----LKPMLNFILRSASGIN 500
            .:.|.::.|.|||:.|:|:.||..:||::...:|.|:......|.    .|.||.  |....|::
plant   440 ESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADENSKVYYKRMLT--LHVDGGLH 502

  Fly   501 VGLRPR 506
            :...||
plant   503 LCAIPR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 114/447 (26%)
CYP704A2NP_182075.1 PLN03195 15..509 CDD:215627 118/462 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H82150
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 1 1.000 T32115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.