DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP704A1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_850427.2 Gene:CYP704A1 AraportID:AT2G44890 Length:511 Species:Arabidopsis thaliana

Alignment Length:485 Identity:121/486 (25%)
Similarity:204/486 (42%) Gaps:94/486 (19%)


  Fly    70 TFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEY---------LRPFLNDGLLVSTGRKWH 125
            ||||...|:|.|:|.|.:..|.||       |.:.:.|         |...|..|:....|.||.
plant    70 TFRFLSPGQSEIFTADPRNVEHIL-------KTRFHNYSKGPVGTVNLADLLGHGIFAVDGEKWK 127

  Fly   126 ARRKIFTHAFHFKVLEHY-VEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGV 189
            .:||:.:..|..:||.:: ..:....:|.:|..:.:.|....:.|....:....||.|.:...||
plant   128 QQRKLVSFEFSTRVLRNFSYSVFRTSASKLVGFIAEFALSGKSFDFQDMLMKCTLDSIFKVGFGV 192

  Fly   190 QVN-----AQNDPDF-----------------PYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAP 232
            ::.     ::...:|                 |:.| ||..:.|..:                  
plant   193 ELGCLDGFSKEGEEFMKAFDEGNGATSSRVTDPFWK-LKCFLNIGSE------------------ 238

  Fly   233 LLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSIN 297
               .:|...|.::..|...:|:.:|:.:  :|...|            |..:..|...||:|..:
plant   239 ---SRLKKSIAIIDKFVYSLITTKRKEL--SKEQNT------------SVREDILSKFLLESEKD 286

  Fly   298 NQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASA------ 356
            .:.::|..:|:.:...|..|.|||::.:|..||.:.::|.||::|.:|::.|.......      
plant   287 PENMNDKYLRDIILNVMVAGKDTTAASLSWFLYMLCKNPLVQEKIVQEIRDVTSSHEKTTDVNGF 351

  Fly   357 --PVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVLYYAHRDA 418
              .||:..|..::||...:.||||||||||...|.|:.:..:.| ..:....:||.:.|...| .
plant   352 IESVTEEALAQMQYLHAALSETMRLYPPVPEHMRCAENDDVLPDGHRVSKGDNIYYISYAMGR-M 415

  Fly   419 NYF--PDPLSFRPERFLEDQE-QGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLP 480
            .|.  .|...|:|||:|:|.. |..:.|.::.|.|||:.|||:.||..:||::...:|.|:....
plant   416 TYIWGQDAEEFKPERWLKDGVFQPESQFKFISFHAGPRICIGKDFAYRQMKIVSMALLHFFRFKM 480

  Fly   481 LGE----ELKPMLNFILRSASGINVGLRPR 506
            ..|    ..|.||.  |....|:::...||
plant   481 ADENSKVSYKKMLT--LHVDGGLHLCAIPR 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 117/471 (25%)
CYP704A1NP_850427.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H82150
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 1 1.000 T32115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.