DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp26b1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001072655.1 Gene:cyp26b1 XenbaseID:XB-GENE-991500 Length:511 Species:Xenopus tropicalis

Alignment Length:538 Identity:126/539 (23%)
Similarity:202/539 (37%) Gaps:126/539 (23%)


  Fly     5 LITGALILL-------LTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWV-- 60
            |::.||:|.       |.|...|.:...|...|    |.:..|::|   :..|        |:  
 Frog    19 LVSVALLLAVSQQLWQLRWAATRDKSCKLPIPK----GSMGFPLVG---ETFH--------WILQ 68

  Fly    61 GEKF-----DKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLN-DGLLVS 119
            |..|     :|||..|:..:||..||.....:....||.....|...:.....|..|. :.|..|
 Frog    69 GSDFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNSLANS 133

  Fly   120 TGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITE 184
            .|.....:||:|:..|..:.||.|   :.:...|:.|.||..:....:::               
 Frog   134 IGDIHRHKRKVFSKIFSHEALESY---LPKIQLVIQDTLRVWSSNPESIN--------------- 180

  Fly   185 AAMGVQVNAQNDPDFPYIKALKSVVYIQPDRM-FRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDF 248
                                    ||.:..:: ||.:.|....|.|:    ..:|....:|...|
 Frog   181 ------------------------VYCEAQKLTFRMAIRVLLGFRLS----DEELSQLFQVFQQF 217

  Fly   249 TDKVIS--------------ERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQS----- 294
            .:.|.|              ..||.:.::........|.    ....|.....||||::|     
 Frog   218 VENVFSLPVDVPFSGYRRGIRAREMLLKSLEKAIQEKLQ----NTQGKDYADALDILIESGKEHG 278

  Fly   295 -SINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQ--RVL--GPDA 354
             .:..|.|.|..:.     .:|....||:|..:..:..:.:||.|.:::.|||:  .:|  |...
 Frog   279 KELTMQELKDGTLE-----LIFAAYATTASASTSLIMQLLKHPSVLEKLREELRGNSILHNGCVC 338

  Fly   355 SAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDAN 419
            ...:....:..|.||||||||.:||:.||....|...:..|:....||...|:...:...|..|.
 Frog   339 EGALRVETISSLHYLDCVIKEILRLFSPVSGGYRTVLQTFELDGFQIPKGWSVLYSIRDTHDTAP 403

  Fly   420 YFPDPLSFRPERFLEDQ-EQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVL---ISKVLRFY---- 476
            .|.|...|.|:||.:|: |.....|.|:||..|.:||:|:..|.|.:|||   ::.:.||.    
 Frog   404 VFKDVDVFDPDRFGQDRTEDKDGRFHYLPFGGGVRNCLGKHLAKLFLKVLAIELASMSRFELATR 468

  Fly   477 ---ELLPL-----GEELK 486
               :::|:     .:|||
 Frog   469 TFPKIMPVPVVHPADELK 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 117/503 (23%)
cyp26b1NP_001072655.1 p450 1..468 CDD:325183 122/519 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.