DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp26c1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001025122.2 Gene:cyp26c1 ZFINID:ZDB-GENE-050714-2 Length:554 Species:Danio rerio

Alignment Length:573 Identity:125/574 (22%)
Similarity:210/574 (37%) Gaps:135/574 (24%)


  Fly     3 LTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWV--GEKF- 64
            |.|....|:....|...|.|...|...:    |.:..|::|   :..|        |:  |..| 
Zfish    24 LLLAVSRLLWEFRWSITRDRTCKLPLPQ----GSMGWPLVG---ETFH--------WLFQGSSFH 73

  Fly    65 ----DKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWH 125
                :|:||.|:..:||:.||.....:....||.....:...|..:..|..|....||::....|
Zfish    74 ISRREKHGKVFKTHLLGKPLIRVTGAENIRKILLGEHTVVCTQWPQSTRIILGPNTLVNSVGDLH 138

  Fly   126 AR-RKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGV 189
            .| ||:....|....||.|   :.|...|:...:.|......:|::..........:.....:|:
Zfish   139 KRKRKVLAKVFSRGALEAY---LTRLQDVVKSEIAKWCTETGSVEVYTAAKSLTFRIAVRVLLGL 200

  Fly   190 QVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLF--PLAAPLLHRQLLSDIR---VMHDFT 249
            .:..|            .:.|:..    .|.:..|.||  |:..|:  ..|...||   ::|...
Zfish   201 HLEEQ------------QITYLSK----TFEQLMNNLFSLPIDTPV--SGLRKGIRAREILHSAM 247

  Fly   250 DKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMA-----LLDILLQSS-INNQPLSDADIRE 308
            :|:|.|:                        .|.|.|     ..|.:|.|: .|:..|:..:::|
Zfish   248 EKIIEEK------------------------LKKQQASDYCDAFDYMLSSARENDYELTMQELKE 288

  Fly   309 EVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQ--------------RVLG-------- 351
            .....:|....||:|..:..:..:.|||:|.:|...||:              |..|        
Zfish   289 TAVELIFAAHSTTASASTSLIMQLLRHPDVSERARAELESEGLITDGHGHCRSRCNGNAISEEGE 353

  Fly   352 ------PDASAPVTQA------------------------QLQDLKYLDCVIKETMRLYPPVPAI 386
                  .|..:.:.:|                        :|..|.|||||:||.:|..|||...
Zfish   354 AAEKSTSDRRSAINKATYFEAGDKEEGRRSRTHVPYLSLEKLSQLSYLDCVVKEVLRFLPPVSGG 418

  Fly   387 GRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHN-TFAYVPFSA 450
            .|...:..|:....||...|:...:...|..|..:.:|..|.|:||...:|:..: .|:||||..
Zfish   419 YRTVLQTFELNGYQIPKGWSVMYSIRDTHETAEAYQNPELFDPDRFCVGREESKSERFSYVPFGG 483

  Fly   451 GPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLNF--ILRSASGINV 501
            |.:.|||::.|::.:|.|..::|...: ..|..:..|.:..  |:...:|::|
Zfish   484 GVRRCIGRELALIVLKTLAVELLATAD-CTLATQTYPRMQTVPIVHPVNGLHV 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 116/533 (22%)
cyp26c1NP_001025122.2 p450 23..533 CDD:299894 124/570 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.