DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp3a41a

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_059092.2 Gene:Cyp3a41a MGIID:1858451 Length:504 Species:Mus musculus

Alignment Length:528 Identity:139/529 (26%)
Similarity:258/529 (49%) Gaps:69/529 (13%)


  Fly     2 WLTLITGALILLLTWDFGRKRQRVLAFEKSAIPGPISIPILGC------GLQALHLGAENIIGWV 60
            |:.|   |:||:|.:.:|.:...:  |:|..||||..:|.||.      ||....:         
Mouse    12 WVLL---AIILVLLYRYGTRTHGL--FKKQGIPGPKPLPFLGTVLNYYKGLWKFDM--------- 62

  Fly    61 GEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPF-----LNDGLLVST 120
             |.::|||||:..:.....|....|.:..:.:|    :.|...::...|.|     ::..:.:|.
Mouse    63 -ECYEKYGKTWGLFDGQMPLFVITDPEMIKNVL----VKECFSVFTNRREFGPVGIMSKAISISK 122

  Fly   121 GRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEA 185
            ..:|...|.:.:..|....|:....:::::..::|..|.:.|:....|.|...:...::||||..
Mouse   123 DEEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLMQEAEKGKPVTMKDVLGAYSIDVITST 187

  Fly   186 AMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHD--- 247
            :.||.|::.|:|:.|:::..|.::.:.......||   ..|||...|:.  ::|:......|   
Mouse   188 SFGVNVDSLNNPEDPFVEKAKGILRVDFFDPLVFS---VVLFPFLTPVY--EMLNICMFPKDSIE 247

  Fly   248 FTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSIN------NQPLSDADI 306
            |..|.::..:|:...:|                .|.::..|.:::.:..|      ::.|||.:|
Mouse   248 FFKKFVNRMKESRLDSK----------------QKHRVDFLQLMMNAHNNSKDKDSHKALSDMEI 296

  Fly   307 REEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDC 371
            ..:...|:|.|.:||||.:|..||.:|.||::|:::.||:...| |: .||.|...:.:::|||.
Mouse   297 TAQSIVFIFAGYETTSSTLSFTLYCLATHPDIQKKLQEEIDETL-PN-KAPPTYDTVMEMEYLDM 359

  Fly   372 VIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQ 436
            |:.||:||||....:.|..:|::|:....||..:::.:..|..|.|..::|:|..|:||||.::.
Mouse   360 VLNETLRLYPIGNRLERFCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWPEPEEFQPERFSKEN 424

  Fly   437 EQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLNFILRSASGINV 501
            :...:.:.|:||..||:||||.:||.:.||:.::||::.:...|..|...|    :..|..|:  
Mouse   425 KGSIDPYLYMPFGIGPRNCIGMRFAFMTMKLALTKVMQNFSFQPCQETQIP----LKLSRQGL-- 483

  Fly   502 GLRPRKAL 509
             |:|.|.:
Mouse   484 -LQPEKPI 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 124/479 (26%)
Cyp3a41aNP_059092.2 p450 39..494 CDD:278495 129/497 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.