DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp4f40

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001102830.1 Gene:Cyp4f40 RGDID:1559596 Length:523 Species:Rattus norvegicus

Alignment Length:487 Identity:161/488 (33%)
Similarity:246/488 (50%) Gaps:56/488 (11%)


  Fly    50 HLG----AENIIGWVGEKFDKYGKTFRFWILGE--SLIYTKDLQYFETILSSTTLL--EKGQLYE 106
            |||    .|..:..:.|....|.:.|..| ||.  .||.........::||::..:  :.|..|.
  Rat    63 HLGMSPPTEEGMKQMTELVATYPQGFMTW-LGPIVPLITLCHPDIIRSVLSASAAVAPKDGIFYS 126

  Fly   107 YLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTA-VDM 170
            :|:|:|.||||||...||...|.:.|.||||.:|:.||:|.:..:::|.....::|.|.:| :||
  Rat   127 FLKPWLGDGLLVSASDKWSRHRSMLTPAFHFNILKPYVKIFNDSTNIMHAKWLRLASGGSAHLDM 191

  Fly   171 LKYVSLAALDVITEAAMGVQVNAQNDPDFPYIKA---LKSVVYIQPDRMFRFSRRYNWLFPLAAP 232
            .:.:||..||.:.:.......|.|..|. .||.|   |.::|..:.:::                
  Rat   192 FENISLMTLDTLQKCVFSFNSNCQEKPS-EYIAAILELSALVVKRNEQL---------------- 239

  Fly   233 LLHRQLLSDI-----------RVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMA 286
            |||..||..:           .::||||..||.|||.|:          |...||..|.:|::..
  Rat   240 LLHMDLLYRLTPDGRRFYKACHLVHDFTYAVIQERRRTL----------PKHGGDDVIKAKAKSK 294

  Fly   287 LLD----ILLQSSINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQ 347
            .||    :||....:.:.|||.|||.|.|||||||.|||:||:|..||.:|:|||.|:|..:|:|
  Rat   295 TLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPEYQERCRQEVQ 359

  Fly   348 RVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD-KTIPANTSIYLVL 411
            .:|....|..:....|..|.:|...|||::||:|||..:.|...:::.:.| :.||......:.:
  Rat   360 ELLRDRDSEEIEWDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDISLPDGRVIPKGIICIINI 424

  Fly   412 YYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFY 476
            :..|.:...:.||..:.|.||..:..|..:..|::||||||:|||||.||:.||||.::..|..:
  Rat   425 FATHHNPTVWQDPEVYDPFRFDPENIQARSPLAFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRF 489

  Fly   477 ELLPLGEELKPMLNFILRSASGINVGLRPRKA 508
            .:||..:|.:.....|||:..|:.:.:.|..|
  Rat   490 RVLPDDKEPRRKPELILRAEDGLWLRVEPLSA 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 156/471 (33%)
Cyp4f40NP_001102830.1 p450 52..514 CDD:278495 159/479 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114635273
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.