DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp4p1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_524828.1 Gene:Cyp4p1 FlyBaseID:FBgn0015037 Length:513 Species:Drosophila melanogaster

Alignment Length:529 Identity:170/530 (32%)
Similarity:267/530 (50%) Gaps:49/530 (9%)


  Fly     1 MWLTLITGALILLLTW-----------DFGRKRQRVLAFEKSAIPGPISIP------ILGCGLQA 48
            :||.|   ||..||.|           .|..||.|:    |...|..|..|      |.|..|..
  Fly     4 LWLIL---ALSALLYWLHRANKDYHILSFFTKRIRL----KDGTPVEIIAPIAKGKTIFGNTLDL 61

  Fly    49 LHLGAENIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLN 113
            .......:..:..|:..:.|.::..::.|:::....|....|.:|:...|:.||.:|.:|.|||.
  Fly    62 YGRDHAGVFNYSRERAKEMGTSYIEYVFGKAIYNIIDADSAENVLNHPNLITKGLVYNFLHPFLR 126

  Fly   114 DGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAA 178
            .|||.|||:|||||||:.|..|||.:|..:.||....|...:  |:.....:..:.:...:....
  Fly   127 TGLLTSTGKKWHARRKMLTPTFHFNILNQFQEIFKTESQKFL--LQFEGQDEVTITLHDVIPRFT 189

  Fly   179 LDVITEAAMGVQVNAQNDPDFPYIKALKSV--VYIQPDRMFRFSRRYNW---LFPLAAPLLHRQL 238
            |:.|.|.||||:::...:....|.:....:  .:|:     |.|....|   ||.:.|.   :..
  Fly   190 LNSICETAMGVKLDEMAEKGDRYRENFSQIEECFIR-----RLSNPLLWGDKLFEMFAA---KDF 246

  Fly   239 LSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAE-IGSKSQMALLDILLQSSINNQPLS 302
            .|.:.|:|.|:.::|::||:.::    |...:..|..|.: ..||.:.|:||.|:.:. .:..:.
  Fly   247 ASALDVVHRFSSEIIAKRRDLLK----DELDKSSSTADDDGFVSKKRFAMLDTLIYAE-KDGLID 306

  Fly   303 DADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLK 367
            ...|.|||||.||||.||||.|:...|..::.:|:.|:..::|:|..:..|.| .:...||..||
  Fly   307 HIGICEEVDTLMFEGYDTTSIGLIFGLMNMSLNPDKQELCYQEIQEHIDDDLS-NLDVGQLNKLK 370

  Fly   368 YLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTI-PANTSIYLVLYYAHRDANYFPDPLSFRPER 431
            ||:..:|||.||:|.||.:||.|.:|.|:.:..| |....|.:.::..||:|.|:..|..|||||
  Fly   371 YLEYFMKETTRLFPSVPIMGREAVQETELANGLILPKGAQITIHVFDIHRNAKYWDSPEEFRPER 435

  Fly   432 FLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLN--FILR 494
            ||.:..|..:|:||||||||.:||||:|:|:.|||.|:..:|:.:::|...:..|.:.:  ..||
  Fly   436 FLPENVQDRHTYAYVPFSAGQRNCIGKKYAMQEMKTLMVVLLKQFKVLKAIDPQKIVFHTGITLR 500

  Fly   495 SASGINVGL 503
            :...|.|.|
  Fly   501 TQDKIRVKL 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 152/474 (32%)
Cyp4p1NP_524828.1 p450 54..509 CDD:278495 153/471 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114601288
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.