DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp46a1.2

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_009292815.1 Gene:cyp46a1.2 ZFINID:ZDB-GENE-040426-1184 Length:501 Species:Danio rerio

Alignment Length:454 Identity:128/455 (28%)
Similarity:209/455 (46%) Gaps:53/455 (12%)


  Fly    65 DKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYL-----RPFLNDGLLVSTGRK- 123
            :|||..:|...|....|.....:..:|||.|....:....|..|     :.||.:||:.:.... 
Zfish    74 EKYGPVYRINTLHYIAILVHCPEATKTILMSPKYAKDPFSYSRLFNLFGKRFLGNGLVTAVDHDI 138

  Fly   124 WHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMG 188
            |:.:|:|...||....|...:...|..|..::|.|.::|:.||...|...|:...||||.:.|.|
Zfish   139 WYRQRRIMDPAFSSSYLRSLISTFDEMSERLMDKLEEMANNKTPAVMHDLVNCVTLDVICKVAFG 203

  Fly   189 VQVNAQNDPDFPYIKA----LKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIR----VM 245
            |.:|.....|.|:..|    |..:.....|.:||...: ||           :|:..||    ::
Zfish   204 VDLNFLTQKDSPFQNAIELCLNGMALDARDPLFRIFPK-NW-----------KLIQQIRDAAVLL 256

  Fly   246 HDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEV 310
            ....:|.|..|:..|:..:             ::.......:|.|..:.::|    |..|:.:.:
Zfish   257 RKTGEKWIQNRKTAVKNGE-------------DVPKDILTQILKIAEEENVN----SSEDLEQMM 304

  Fly   311 D---TFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCV 372
            |   ||...|.:||::.:|.|:.|:.|:||:.:|...|:..|||  ....::...|..|.||..|
Zfish   305 DNFVTFFIAGQETTANQLSFAIMALGRNPEIYKRAKAEVDEVLG--TKREISNEDLGKLTYLSQV 367

  Fly   373 IKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQE 437
            :|||:||||..|...|...:::.|....||...|:....:.:.|...:|.|||.|.||||.|:..
Zfish   368 LKETLRLYPTAPGTNRWLHEDMIINGIKIPGGCSVMFSSFVSQRLEKFFKDPLKFDPERFDENAP 432

  Fly   438 QGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYE--LLPLGEELKPMLNFILRSASGI 499
            :.:  :.|.||:.||:.|:||.|:.:|.||:::|:|:.:|  |:| |:.........||..||:
Zfish   433 KPY--YCYYPFALGPRTCLGQVFSQMEAKVVLAKLLQRFEFSLVP-GQSFDIKDTGTLRPKSGV 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 124/447 (28%)
cyp46a1.2XP_009292815.1 p450 39..495 CDD:278495 128/455 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.