DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp26b1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_997831.1 Gene:cyp26b1 ZFINID:ZDB-GENE-030131-2908 Length:511 Species:Danio rerio

Alignment Length:491 Identity:121/492 (25%)
Similarity:192/492 (39%) Gaps:83/492 (17%)


  Fly     5 LITGALILL-------LTWDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGWVGE 62
            |::.||:|.       |.|...|.:...|...|    |.:..||:|........||    |:...
Zfish    19 LVSMALLLAVSQQLWQLRWTATRDKSCKLPMPK----GSMGFPIIGETCHWFFQGA----GFHAS 75

  Fly    63 KFDKYGKTFRFWILGESLIYTKDLQYFETIL-------------SSTTLLEKGQLYEYLRPFLND 114
            :..|||..|:..:||..||.....:....:|             |::|||....|..        
Zfish    76 RRQKYGNVFKTHLLGRPLIRVTGAENVRKVLMGEHSLVTVDWPQSTSTLLGPNSLAN-------- 132

  Fly   115 GLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAAL 179
                |.|.....|||||...|..:.||.|   :.:...|:.:.||..:.....:::.:.....:.
Zfish   133 ----SIGDIHRKRRKIFAKVFSHEALESY---LPKIQQVIQETLRVWSSNPDPINVYRESQRLSF 190

  Fly   180 DVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRV 244
            ::.....:|.::..:.      :..|.|.          |......:|.|...|........||.
Zfish   191 NMAVRVLLGFRIPEEE------MHCLFST----------FQEFVENVFSLPIDLPFSGYRKGIRA 239

  Fly   245 MHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSS-INNQPLSDADIRE 308
            .......:....||           :||     ....|.....||:||:|: .||..|:..:::|
Zfish   240 RDSLQKSIEKAIRE-----------KPL-----HTQGKDYTDALDVLLESAKENNTELTMQELKE 288

  Fly   309 EVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQ-----DLKY 368
            .....:|....||:|..:..:..:.|||.|.:::.||| |..|......:.|.:|:     .|||
Zfish   289 STIELIFAAFATTASASTSLVMQLLRHPAVLEKLREEL-RSCGLLHDGCLCQGELRLDSIISLKY 352

  Fly   369 LDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFL 433
            |||||||.:||:.||....|.|.:..|:....:|...|:...:...|..:..|.|..:|.|:||.
Zfish   353 LDCVIKEVLRLFAPVSGGYRIATQTFELDGVQVPKGWSVMYSIRDTHDTSAVFKDVEAFDPDRFS 417

  Fly   434 -EDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVL 468
             |..|.....|.|:||..|.::|:|::.|.|.:|:|
Zfish   418 PERSEDREGRFHYLPFGGGVRSCLGKQLATLFLKLL 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 112/456 (25%)
cyp26b1NP_997831.1 p450 1..489 CDD:299894 121/492 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.