DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp4ae1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_525044.1 Gene:Cyp4ae1 FlyBaseID:FBgn0015036 Length:496 Species:Drosophila melanogaster

Alignment Length:508 Identity:203/509 (40%)
Similarity:307/509 (60%) Gaps:16/509 (3%)


  Fly     1 MWLTLITGALILLLTWDFGRKRQRVLAFE-KSAIPGPISIPILGCGLQALHLGAENIIGWVGEKF 64
            |.:.|:...|:..|.....|...:.|... :..:|....:|:||...|......:|:.....|..
  Fly     1 MLVVLLVALLVTRLVASLFRLALKELRHPLQGVVPSVSRVPLLGAAWQMRSFQPDNLHDKFAEYV 65

  Fly    65 DKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWHARRK 129
            .::|::|...:||..::.|.:.::.:.:|.....|:||.:|..||.:|.||||:|.|::||..||
  Fly    66 KRFGRSFMGTVLGHVVMVTAEPRHIDALLQGQHQLKKGTMYFALRGWLGDGLLLSRGKEWHTMRK 130

  Fly   130 IFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQ 194
            |.|..|||.:||.:||:.||.||::|:.||.::.|...|::...|.|||||:|||.||||.|:||
  Fly   131 IITPTFHFSILEQFVEVFDRQSSILVERLRTLSYGNEVVNIYPLVGLAALDIITETAMGVNVDAQ 195

  Fly   195 NDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRET 259
            . .|...:.|:|.:..|...|..|....:..||.|..|...|:..:.:..:|:||:.:|.:||..
  Fly   196 G-ADSEVVHAVKDLTNILATRFMRPHLLFPHLFRLCWPSGFRKQQAGVICLHEFTNGIIEQRRRL 259

  Fly   260 V-RRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSS 323
            : |.|..|...:|             .||||.||:::::.|||:|..||:||:||:|||.|||:|
  Fly   260 LAREANQDKPTKP-------------HALLDTLLRATVDGQPLTDKQIRDEVNTFIFEGHDTTTS 311

  Fly   324 GVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGR 388
            .||..||.::||..|||::||||:...|.|....|..:....|.||.||:||::|||||:||:.|
  Fly   312 AVSFCLYLLSRHEAVQQKLFEELRMHYGQDLFRGVILSDFATLPYLSCVVKESLRLYPPIPAVAR 376

  Fly   389 HAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPK 453
            ..:|:|.|.:..||..|::.::|:...||...|.|||.|:|||.|.::....:.::|:||||||:
  Fly   377 CLEKDLVIDEGYIPVGTNVVVLLWQLLRDEAIFTDPLVFQPERHLGEEAPRLSPYSYIPFSAGPR 441

  Fly   454 NCIGQKFAVLEMKVLISKVLRFYELLPLGEELKPMLNFILRSASGINVGLRPR 506
            ||||||||:||||.:::||:|.|:|||:|.:::|.:..:|||.||:|||||||
  Fly   442 NCIGQKFALLEMKTMVTKVIRHYQLLPMGADVEPSIKIVLRSKSGVNVGLRPR 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 185/460 (40%)
Cyp4ae1NP_525044.1 p450 35..486 CDD:278495 189/465 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131158483
eggNOG 1 0.900 E2759_KOG0157
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1500
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24291
RoundUp 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.