DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and CYP4V2

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 HGNCID:23198 Length:525 Species:Homo sapiens

Alignment Length:534 Identity:190/535 (36%)
Similarity:295/535 (55%) Gaps:52/535 (10%)


  Fly     1 MW-----LTLITGALILLLTWDFGRKRQRVLAFEKS-----AIPGPI-SIPILGCGLQALHLGAE 54
            :|     |:|...:|:|.|.       |||.::.:.     .||... :.|::|..|.....|.|
Human    15 LWGAASALSLAGASLVLSLL-------QRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGRE 72

  Fly    55 ---NIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGL 116
               .||.:..|.  ::....:.|:....::...:.:..|.||:|:..::|..:|::|.|:|..||
Human    73 FFQQIIEYTEEY--RHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGL 135

  Fly   117 LVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDV 181
            |.|||.||.:|||:.|..|||.:||.:::||:..::::|..|.|..: :.|.:...|::|.|||:
Human   136 LTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHIN-QEAFNCFFYITLCALDI 199

  Fly   182 ITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLL------HRQLLS 240
            |.|.|||..:.||::.|..|::|    ||...:.:|| ..:..||:.....|:      |::   
Human   200 ICETAMGKNIGAQSNDDSEYVRA----VYRMSEMIFR-RIKMPWLWLDLWYLMFKEGWEHKK--- 256

  Fly   241 DIRVMHDFTDKVISERRETVRR---AKADGTYRPLSLGDAEIGSKSQMALLDILLQ-SSINNQPL 301
            .::::|.||:.||:||...:..   .:.||.      |.|...:| :.|.||:||. :......|
Human   257 SLQILHTFTNSVIAERANEMNANEDCRGDGR------GSAPSKNK-RRAFLDLLLSVTDDEGNRL 314

  Fly   302 SDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDL 366
            |..|||||||||||||.|||::.::.:||.:..:||||:::..||..|.| .:..|.|...|:.|
Human   315 SHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFG-KSDRPATVEDLKKL 378

  Fly   367 KYLDCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPER 431
            :||:||||||:||:|.||...|...::.|:....:...|...::.|..|||..|||:|..|:|||
Human   379 RYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPER 443

  Fly   432 FLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFY--ELLPLGEELKPMLNFILR 494
            |..:..||.:.:|||||||||:|||||||||:|.|.::|.:||.:  |.....|||......|||
Human   444 FFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILR 508

  Fly   495 SASGINVGLRPRKA 508
            .::||.:.|:.|.|
Human   509 PSNGIWIKLKRRNA 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 173/475 (36%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 176/481 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114684626
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.