DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp4a12a

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a MGIID:88612 Length:508 Species:Mus musculus

Alignment Length:497 Identity:146/498 (29%)
Similarity:243/498 (49%) Gaps:85/498 (17%)


  Fly    59 WVGEKFDKYGKTFRFWILGESLIYTKDLQ------------------------------YFETIL 93
            |:.....::......|:.|..::..:|||                              |.:.||
Mouse    43 WLLSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLIL 107

  Fly    94 SSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNL 158
            ..:.....|. |.:|.|::..|||:..|:.|...|::.|.|||:.:|:.|.|||.....||:|..
Mouse   108 GRSDPKANGS-YRFLAPWIGRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVMLDKW 171

  Fly   159 RKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQNDPDF-PYIKALKSV----------VYIQ 212
            .::....:.:::.::::|..||.|.:.|...:.:.|.|..: .||:|::.:          ::.|
Mouse   172 EQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQ 236

  Fly   213 PDRMFRFSR---RYNWLFPLAAPLLHRQLLSDIRVMHDFTDKVISERRETVRRAKADGTYRPLSL 274
            .|.::|.|.   :.|               |..::.||.||:||..||              :.|
Mouse   237 NDIIYRVSSNGCKAN---------------SACKLAHDHTDQVIKSRR--------------IQL 272

  Fly   275 GDAE----IGSKSQMALLDILLQSSI-NNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIAR 334
            .|.|    :..|.::..|||||.:.: |.:.|||.|:|.|||||||||.|||:||:|...||:|.
Mouse   273 QDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALAT 337

  Fly   335 HPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD- 398
            :||.|||..:|:|.:||...|  :|...|..:.|....|||.:|:|||||::.|.....:...| 
Mouse   338 NPEHQQRCRKEIQSLLGDGTS--ITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDG 400

  Fly   399 KTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVL 463
            :::|....:.|..|..|.:...:|:|..|.|.||.....:  ::.:::|||.|.:||||::||:.
Mouse   401 RSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSR--HSHSFLPFSGGARNCIGKQFAMN 463

  Fly   464 EMKVLISKVLRFYELLPLGEELK-PMLNFILRSASGINVGLR 504
            |:||.::..|..:||||....:. |:...:|:|.:||::.|:
Mouse   464 ELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLK 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 141/485 (29%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 144/484 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114332208
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.